(data stored in ACNUC7421 zone)

EMBL: AE006468.CITE2

AE006468.CITE2       Location/Qualifiers
FT   CDS             70000..70869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE2"
FT                   /locus_tag="STM0060"
FT                   /product="putative citrate lyase beta chain, acyl lyase
FT                   subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="similar to E. coli citrate lyase beta chain (acyl
FT                   lyase subunit) (AAC73717.1); Blastp hit to AAC73717.1 (307
FT                   aa), 63% identity in aa 17 - 306"
FT                   /db_xref="EnsemblGenomes-Gn:STM0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19024"
FT                   /db_xref="GOA:Q8ZRY2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY2"
FT                   /protein_id="AAL19024.1"
FT                   /translation="MRPRRSMLFIPGANAAMLSTSFVYGADAVMFDLEDAVALREKDTA
FT                   RLLVHHALQHPFYQDVEKVVRINPLNTPFGLADLEAVVRGGADIVRLPKTDSKNDVLEL
FT                   EAQVERIERECGREVGSTRLMAAIESAKGVVNAVDIATSSPRMVAIALAAFDYVMDMGT
FT                   SRGDGTELFYARCAVLHAARVAGIAAYDVVWSDINNEEGFLKEVQLAKGLGFNGKSLVN
FT                   PRQIELLHQAYSPTRKEVEHAYEVIAAAEEAESRGLGVVSLNGKMIDGPIIDHARKVVA
FT                   LSASGIRD"
     MRPRRSMLFI PGANAAMLST SFVYGADAVM FDLEDAVALR EKDTARLLVH HALQHPFYQD        60
     VEKVVRINPL NTPFGLADLE AVVRGGADIV RLPKTDSKND VLELEAQVER IERECGREVG       120
     STRLMAAIES AKGVVNAVDI ATSSPRMVAI ALAAFDYVMD MGTSRGDGTE LFYARCAVLH       180
     AARVAGIAAY DVVWSDINNE EGFLKEVQLA KGLGFNGKSL VNPRQIELLH QAYSPTRKEV       240
     EHAYEVIAAA EEAESRGLGV VSLNGKMIDG PIIDHARKVV ALSASGIRD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page