(data stored in ACNUC7421 zone)

EMBL: AE006468.CITX2

AE006468.CITX2       Location/Qualifiers
FT   CDS             72400..72951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX2"
FT                   /locus_tag="STM0062"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73715.1); Blastp hit to AAC73715.1 (183 aa), 46%
FT                   identity in aa 12 - 167"
FT                   /db_xref="EnsemblGenomes-Gn:STM0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19026"
FT                   /db_xref="GOA:Q8ZRY0"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY0"
FT                   /protein_id="AAL19026.1"
FT                   /translation="MKGTDLLYLGQAVTLEEMLQARDKRAARQRQALNCYRLPLISLTL
FT                   VAPGAVKNSAVWRRVADYAIAEILALCEQMEWVNVWEMQVNERSGPEWMAAVCAPAMAL
FT                   KQHMSTLEMSHPLGRLWDIDIIDSDGKSLSRRELGHPARPCLICQQDAHLCARGKHHTL
FT                   DLLLDEIARRIECYERERCD"
     MKGTDLLYLG QAVTLEEMLQ ARDKRAARQR QALNCYRLPL ISLTLVAPGA VKNSAVWRRV        60
     ADYAIAEILA LCEQMEWVNV WEMQVNERSG PEWMAAVCAP AMALKQHMST LEMSHPLGRL       120
     WDIDIIDSDG KSLSRRELGH PARPCLICQQ DAHLCARGKH HTLDLLLDEI ARRIECYERE       180
     RCD                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page