(data stored in ACNUC7421 zone)

EMBL: AE006468.CUEO

AE006468.CUEO        Location/Qualifiers
FT   CDS             196532..198142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="STM0168"
FT                   /product="putative multicopper oxidase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73234.1); Blastp hit to AAC73234.1 (516 aa), 80%
FT                   identity in aa 1 - 516"
FT                   /db_xref="EnsemblGenomes-Gn:STM0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19132"
FT                   /db_xref="GOA:Q8ZRS2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS2"
FT                   /protein_id="AAL19132.1"
FT                   /translation="MLRRDFLKYSVALGVASALPLWSRAAFAAERPALPIPDLLTADAS
FT                   NRMQLIVKAGQSTFAGKNATTWGYNGNLLGPAVQLHKGKSVTVDIHNQLAEDTTLHWHG
FT                   LEIPGIVDGGPQGIIPAGGTRTVTFTPEQRAATCWIHPHKHGKTGRQVAMGLAGLVLIE
FT                   DDEIRKLRLPKQWGIDDVPVIIQDKRFSADGQIDYQLDIMTAAVGWFGDTLLTNGAIYP
FT                   QHSAPKGWLRLRLLNGCNARSLNIAASDNRPLYVIASDGGLLAEPVKVTELPLLMGERF
FT                   EVLVDISDGKAFDLVTLPVSQMGMAIAPFDKPHPVMRIQPLRITASGTLPDTLTTMPAL
FT                   PSLEGLTVRNLKLSMDPRLDMMGMQMLMKKYGAQAMSGMDHDSMNAHMQGGNMGHGEMD
FT                   HGNMDHSGMNHGAMGNMNHGGKFDFHNANFINGQVFDMNKPMFAAQKGRHERWVISGVG
FT                   DMMLHPFHIHGTQFRILSENGKAPAAHRTGWKDTVRVEGGISEVLVKFDHDAPKEHAYM
FT                   AHCHLLEHEDTGMMLGFTV"
     MLRRDFLKYS VALGVASALP LWSRAAFAAE RPALPIPDLL TADASNRMQL IVKAGQSTFA        60
     GKNATTWGYN GNLLGPAVQL HKGKSVTVDI HNQLAEDTTL HWHGLEIPGI VDGGPQGIIP       120
     AGGTRTVTFT PEQRAATCWI HPHKHGKTGR QVAMGLAGLV LIEDDEIRKL RLPKQWGIDD       180
     VPVIIQDKRF SADGQIDYQL DIMTAAVGWF GDTLLTNGAI YPQHSAPKGW LRLRLLNGCN       240
     ARSLNIAASD NRPLYVIASD GGLLAEPVKV TELPLLMGER FEVLVDISDG KAFDLVTLPV       300
     SQMGMAIAPF DKPHPVMRIQ PLRITASGTL PDTLTTMPAL PSLEGLTVRN LKLSMDPRLD       360
     MMGMQMLMKK YGAQAMSGMD HDSMNAHMQG GNMGHGEMDH GNMDHSGMNH GAMGNMNHGG       420
     KFDFHNANFI NGQVFDMNKP MFAAQKGRHE RWVISGVGDM MLHPFHIHGT QFRILSENGK       480
     APAAHRTGWK DTVRVEGGIS EVLVKFDHDA PKEHAYMAHC HLLEHEDTGM MLGFTV           536
//

If you have problems or comments...

PBIL Back to PBIL home page