(data stored in ACNUC7421 zone)

EMBL: AE006468.CYOC

AE006468.CYOC        Location/Qualifiers
FT   CDS             complement(494586..495200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="STM0441"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.10.2.-"
FT                   /note="similar to E. coli cytochrome o ubiquinol oxidase
FT                   subunit III (AAC73533.1); Blastp hit to AAC73533.1 (204
FT                   aa), 96% identity in aa 1 - 204"
FT                   /db_xref="EnsemblGenomes-Gn:STM0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19396"
FT                   /db_xref="GOA:Q8ZRC3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC3"
FT                   /protein_id="AAL19396.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGQNKIFGFWVYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMHKNNKSQVISWLAL
FT                   TFLFGAGFIGMELYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   VARRGLTSTNRTRIMCLSLFWHFLDVIWICVFTVVYLMGAM"
     MATDTLTHAT AHAHEHGHHD AGQNKIFGFW VYLMSDCILF SILFATYAVL VNGTAGGPTG        60
     KDIFELPFVL VETFLLLFSS ITYGMAAIAM HKNNKSQVIS WLALTFLFGA GFIGMELYEF       120
     HHLIVNGMGP DRSGFLSAFF ALVGTHGLHV TSGLIWMAVL MVQVARRGLT STNRTRIMCL       180
     SLFWHFLDVI WICVFTVVYL MGAM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page