(data stored in ACNUC7421 zone)

EMBL: AE006468.CYPD

AE006468.CYPD        Location/Qualifiers
FT   CDS             508669..510540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cypD"
FT                   /locus_tag="STM0452"
FT                   /product="peptidyl prolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to E. coli putative protease maturation
FT                   protein (AAC73544.1); Blastp hit to AAC73544.1 (623 aa),
FT                   88% identity in aa 1 - 623"
FT                   /db_xref="EnsemblGenomes-Gn:STM0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19407"
FT                   /db_xref="GOA:Q8ZRB8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRB8"
FT                   /protein_id="AAL19407.1"
FT                   /translation="MMDSLRTAANSLVLKIIFVIIIVSFILTGVSGYLIGGSNNYAAKV
FT                   NGQEISRAQFENAFNNERNRMQQQLGDRYSELAANEGYMKSLRQQVLNRLIDEALLDQY
FT                   SRELKLGISDEQVKQAIFATPAFQVDGKFDNNRYNAIVNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVSQQRVVREAVIDVNALAAKQQVTDQEVSSYYDQNK
FT                   VRFMTPEQFRVSYIKLDAATMQAPVSDADIQAYYDQHVDQFTQPERIRYSIIQTKTEDD
FT                   AKAVLDALNKGEDFATLAKEKSTDIISARNGGDMGWLEESATVPELKNAGLKEKGQISG
FT                   VIKSSVGFLVARLDDIQPAKVKPLSEVRDDIAAKVKQEKALDAYYALQQKVSDAASNDN
FT                   ESLAGAEQVAGVKAVETGWFSRDTLPEELNFKPVADAIFNGGLVGENGTPGPNSDIITV
FT                   DGDRAFVVRVSEHKPEAVKPLAEVKEQVTALVKHNKAEQQAKLDAEKLLVELKAGKGAE
FT                   AMKAAGLSFGEPKTLSRTSQDPVSQAAFALSLPTKDKPVYGVANDMQGNVVLLAFDEVK
FT                   AGAMPEAQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
     MMDSLRTAAN SLVLKIIFVI IIVSFILTGV SGYLIGGSNN YAAKVNGQEI SRAQFENAFN        60
     NERNRMQQQL GDRYSELAAN EGYMKSLRQQ VLNRLIDEAL LDQYSRELKL GISDEQVKQA       120
     IFATPAFQVD GKFDNNRYNA IVNQMGMTAD QYAQALRNQL TTQQLINGVA GTDFMLKGET       180
     DELAALVSQQ RVVREAVIDV NALAAKQQVT DQEVSSYYDQ NKVRFMTPEQ FRVSYIKLDA       240
     ATMQAPVSDA DIQAYYDQHV DQFTQPERIR YSIIQTKTED DAKAVLDALN KGEDFATLAK       300
     EKSTDIISAR NGGDMGWLEE SATVPELKNA GLKEKGQISG VIKSSVGFLV ARLDDIQPAK       360
     VKPLSEVRDD IAAKVKQEKA LDAYYALQQK VSDAASNDNE SLAGAEQVAG VKAVETGWFS       420
     RDTLPEELNF KPVADAIFNG GLVGENGTPG PNSDIITVDG DRAFVVRVSE HKPEAVKPLA       480
     EVKEQVTALV KHNKAEQQAK LDAEKLLVEL KAGKGAEAMK AAGLSFGEPK TLSRTSQDPV       540
     SQAAFALSLP TKDKPVYGVA NDMQGNVVLL AFDEVKAGAM PEAQKKAMVQ GITQNNAQIV       600
     FEALMSNLRK EAKIKIGDAL EQQ                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page