(data stored in ACNUC7421 zone)

EMBL: AE006468.DJLA

AE006468.DJLA        Location/Qualifiers
FT   CDS             108424..109236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="STM0094"
FT                   /product="DnaJ like chaperone protein"
FT                   /note="similar to E. coli putative DNA binding protein
FT                   (AAC73166.1); Blastp hit to AAC73166.1 (271 aa), 95%
FT                   identity in aa 1 - 271"
FT                   /db_xref="EnsemblGenomes-Gn:STM0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19058"
FT                   /db_xref="GOA:Q7CR86"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR86"
FT                   /protein_id="AAL19058.1"
FT                   /translation="MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGDSRTAAQNAFRVG
FT                   KADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNEREVLYVIAEELGI
FT                   SRVQFDQFLRMMQGGAQFGGGYHQQSGGGWQQAQRGPTLEDACNVLGVKTTDDATTIKR
FT                   AYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK"
     MQYWGKIIGV AVALMMGGGF WGVVLGLLVG HMFDKARSRK MAWFANQRER QALFFATTFE        60
     VMGHLTKSKG RVTEADIHIA SQLMDRMNLH GDSRTAAQNA FRVGKADNYP LREKMRQFRS       120
     VCFGRFDLIR MFLEIQIQAA FADGSLHPNE REVLYVIAEE LGISRVQFDQ FLRMMQGGAQ       180
     FGGGYHQQSG GGWQQAQRGP TLEDACNVLG VKTTDDATTI KRAYRKLMSE HHPDKLVAKG       240
     LPPEMMEMAK QKAQEIQKAY ELIKEQKGFK                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page