(data stored in ACNUC7421 zone)

EMBL: AE006468.DNAX

AE006468.DNAX        Location/Qualifiers
FT   CDS             540910..542838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="STM0484"
FT                   /product="DNA polymerase III, tau and gamma subunits"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA elongation factor III; DNA polymerase III
FT                   subunit TAU [contains: DNA polymerase III subunit gamma].
FT                   (SW:DP3X_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19438"
FT                   /db_xref="GOA:P74876"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74876"
FT                   /protein_id="AAL19438.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEAL
FT                   LVEMLSLLHRIAMVQLSPAALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELP
FT                   WAPDRRMGVEMTLLRALAFHPRMPLPEPETPRQSFAPVAPTAVMTPPQLQQPSAPAPQT
FT                   SPAPLPASTSQVLAARNQLQRAQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQA
FT                   RPAPSALETAPVKKEAYRWKATTPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAI
FT                   ERDPWAAQVSQLSLPKLVEQVALNAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALS
FT                   DLTGTTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELD
FT                   EESIRPI"
     MSYQVLARKW RPQTFADVVG QEHVLTALAN GLSLGRIHHA YLFSGTRGVG KTSIARLLAK        60
     GLNCETGITA TPCGVCDNCR EIEQGRFVDL IEIDAASRTK VEDTRDLLDN VQYAPARGRF       120
     KVYLIDEVHM LSRHSFNALL KTLEEPPAHV KFLLATTDPQ KLPVTILSRC LQFHLKALDV       180
     EQIRHQLEHI LNEEHIAHEP RALQLLSRAA DGSLRDALSL TDQAIASGDG QVSTQAVSAM       240
     LGTLDDDQAL SLVEAVVDAN GERVMSLINE AAARGIEWEA LLVEMLSLLH RIAMVQLSPA       300
     ALGSDMAAIE QRMRELARTV PPGDLQLYYQ TLLIGRKELP WAPDRRMGVE MTLLRALAFH       360
     PRMPLPEPET PRQSFAPVAP TAVMTPPQLQ QPSAPAPQTS PAPLPASTSQ VLAARNQLQR       420
     AQGVTKTKKS EPAAASRARP VNNSALERLA SVSERVQARP APSALETAPV KKEAYRWKAT       480
     TPVVQTKEVV ATPKALKKAL EHEKTPELAA KLAAEAIERD PWAAQVSQLS LPKLVEQVAL       540
     NAWKEQNGNA VCLHLRSTQR HLNSSGAQQK LAQALSDLTG TTVELTIVED DNPAVRTPLE       600
     WRQAIYEEKL AQARESIIAD NNIQTLRRFF DAELDEESIR PI                          642
//

If you have problems or comments...

PBIL Back to PBIL home page