(data stored in ACNUC7421 zone)

EMBL: AE006468.FIXA

AE006468.FIXA        Location/Qualifiers
FT   CDS             88684..89454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="STM0075"
FT                   /product="putative flavoprotein reductase, carnitine
FT                   metabolism"
FT                   /note="similar to E. coli probable flavoprotein subunit,
FT                   carnitine metabolism (AAC73152.1); Blastp hit to AAC73152.1
FT                   (268 aa), 87% identity in aa 13 - 268"
FT                   /db_xref="EnsemblGenomes-Gn:STM0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19039"
FT                   /db_xref="GOA:Q8ZRX0"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRX0"
FT                   /protein_id="AAL19039.1"
FT                   /translation="MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAA
FT                   CQLKQQLGDAQVVAMSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQHTATAL
FT                   AAAAQKSGFDLLICGDGSSDLYAQQVGLLVGEALNIPAINGVSKILSLTDSTLTVEREL
FT                   EDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLNSVPAYSAQ
FT                   QVAAPKQRERQRVVIEGDGEEQIAAFVENLRKII"
     MKIITCYKCV PDEQDIAINN ADGTLDFSKA DSKISQYDLN AIEAACQLKQ QLGDAQVVAM        60
     SVGGKALTNA KGRKDVLSRG PDELIVVIDD QFEQALPQHT ATALAAAAQK SGFDLLICGD       120
     GSSDLYAQQV GLLVGEALNI PAINGVSKIL SLTDSTLTVE RELEDEVETL SIPLPAVIAV       180
     STDINTPQIP SMKAILGAAK KPVQVWSPAD IGLNSVPAYS AQQVAAPKQR ERQRVVIEGD       240
     GEEQIAAFVE NLRKII                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page