(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSI

AE006468.FTSI        Location/Qualifiers
FT   CDS             141726..143492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="STM0122"
FT                   /product="division specific transpeptidase"
FT                   /note="penicillin-binding protein 3; similar to E. coli
FT                   septum formation; penicillin-binding protein 3;
FT                   peptidoglycan synthetase (AAC73195.1); Blastp hit to
FT                   AAC73195.1 (588 aa), 96% identity in aa 1 - 588"
FT                   /db_xref="EnsemblGenomes-Gn:STM0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19086"
FT                   /db_xref="GOA:Q7CR83"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR83"
FT                   /protein_id="AAL19086.1"
FT                   /translation="MKAAAKTQKSKRQEEQTNFISWRFALLCGCILLALVFLLGRAAWL
FT                   QIIAPDMLVRQGDMRSLRVQEVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALSTALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLAGTPKDAMRNRTITDVFEPGSTVKPMVVMTALQRGIVNENTVLNTVPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERI
FT                   FPESTVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALATGEKNEF
FT                   VINQGEGTGGRS"
     MKAAAKTQKS KRQEEQTNFI SWRFALLCGC ILLALVFLLG RAAWLQIIAP DMLVRQGDMR        60
     SLRVQEVSTS RGMITDRSGR PLAVSVPVKA IWADPKEVHD AGGISVGDRW KALSTALNIP       120
     LDQLSARINA NPKGRFIYLA RQVNPDMADY IKKLKLPGIH LREESRRYYP SGEVTAHLIG       180
     FTNVDSQGIE GVEKSFDKWL TGQPGERIVR KDRYGRVIED ISSTDSQAAH NLALSIDERL       240
     QALVYRELNN AVAFNKAESG SAVLVDVNTG EVLAMANSPS YNPNNLAGTP KDAMRNRTIT       300
     DVFEPGSTVK PMVVMTALQR GIVNENTVLN TVPYRINGHE IKDVARYSEL TLTGVLQKSS       360
     NVGVSKLALA MPSSALVDTY SRFGLGKATN LGLVGERSGL YPQKQRWSDI ERATFSFGYG       420
     LMVTPLQLAR VYATIGSYGI YRPLSITKVD PPVPGERIFP ESTVRTVVHM MESVALPGGG       480
     GVKAAIKGYR IAIKTGTAKK VGPDGRYINK YIAYTAGVAP ASQPRFALVV VINDPQAGKY       540
     YGGAVSAPVF GAIMGGVLRT MNIEPDALAT GEKNEFVINQ GEGTGGRS                    588
//

If you have problems or comments...

PBIL Back to PBIL home page