(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSL

AE006468.FTSL        Location/Qualifiers
FT   CDS             141345..141710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="STM0121"
FT                   /product="cell division protein"
FT                   /note="ingrowth of wall at septum; similar to E. coli cell
FT                   division protein; ingrowth of wall at septum (AAC73194.1);
FT                   Blastp hit to AAC73194.1 (121 aa), 98% identity in aa 1 -
FT                   121"
FT                   /db_xref="EnsemblGenomes-Gn:STM0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19085"
FT                   /db_xref="GOA:Q7CR84"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7CR84"
FT                   /protein_id="AAL19085.1"
FT                   /translation="MISRVTEALSKVKGSIGSNERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSIGSNE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page