(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSW

AE006468.FTSW        Location/Qualifiers
FT   CDS             148716..149960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="STM0127"
FT                   /product="essential cell division gene"
FT                   /note="stablilzes FtsZ ring; cytoplasmic membrane required
FT                   for PBP2 expression; similar to E. coli cell division;
FT                   membrane protein involved in shape determination
FT                   (AAC73200.1); Blastp hit to AAC73200.1 (414 aa), 90%
FT                   identity in aa 1 - 414"
FT                   /db_xref="EnsemblGenomes-Gn:STM0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19091"
FT                   /db_xref="GOA:Q7CR82"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR82"
FT                   /protein_id="AAL19091.1"
FT                   /translation="MRLSLPRLRMPRVPGFGLLAWLFAALKGWVMASRDKDADSLIMYD
FT                   RTLLWLTFGLAAIGFVMVTSASMPVGQRLANDPFLFAKRDALYIFLAFCLAMVTLRLPM
FT                   TFWQKYSTTMLIASIIMLLIVLVVGSSVNGASRWIALGPLRIQPAEFTKLSLFCYLANY
FT                   LVRKVDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVILLILAEPYRIRRVTSFWNPWEDPFGSGYQLTQSLMAFGRGEIWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYIGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMFLLRIDY
FT                   ETRLEKAQAFTRGSR"
     MRLSLPRLRM PRVPGFGLLA WLFAALKGWV MASRDKDADS LIMYDRTLLW LTFGLAAIGF        60
     VMVTSASMPV GQRLANDPFL FAKRDALYIF LAFCLAMVTL RLPMTFWQKY STTMLIASII       120
     MLLIVLVVGS SVNGASRWIA LGPLRIQPAE FTKLSLFCYL ANYLVRKVDE VRNNLRGFLK       180
     PMGVILVLAV LLLAQPDLGT VVVLFVTTLA MLFLAGAKLW QFIAIIGMGI SAVILLILAE       240
     PYRIRRVTSF WNPWEDPFGS GYQLTQSLMA FGRGEIWGQG LGNSVQKLEY LPEAHTDFIF       300
     AIIGEELGYI GVVLALLMVF FVAFRAMSIG RKALEIDHRF SGFLACSIGI WFSFQALVNV       360
     GAAAGMLPTK GLTLPLISYG GSSLLIMSTA IMFLLRIDYE TRLEKAQAFT RGSR             414
//

If you have problems or comments...

PBIL Back to PBIL home page