(data stored in ACNUC7421 zone)

EMBL: AE006468.FTSZ

AE006468.FTSZ        Location/Qualifiers
FT   CDS             155683..156834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="STM0133"
FT                   /product="tubulin-like GTP-binding protein and GTPase"
FT                   /note="forms circumferential ring in cell division; similar
FT                   to E. coli cell division; forms circumferential ring;
FT                   tubulin-like GTP-binding protein and GTPase (AAC73206.1);
FT                   Blastp hit to AAC73206.1 (383 aa), 98% identity in aa 1 -
FT                   383"
FT                   /db_xref="EnsemblGenomes-Gn:STM0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19097"
FT                   /db_xref="GOA:Q8ZRU0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRU0"
FT                   /protein_id="AAL19097.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDREALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVLDRYQ
FT                   QHGMAPLTQEQKTVAKVVNDNTPQAAKEPDYLDIPAFLRKQAD"
     MFEPMELTND AVIKVIGVGG GGGNAVEHMV RERIEGVEFF AVNTDAQALR KTAVGQTIQI        60
     GSGITKGLGA GANPEVGRNA ADEDREALRA ALEGADMVFI AAGMGGGTGT GAAPVVAEVA       120
     KDLGILTVAV VTKPFNFEGK KRMAFAEQGI TELSKHVDSL ITIPNDKLLK VLGRGISLLD       180
     AFGAANDVLK GAVQGIAELI TRPGLMNVDF ADVRTVMSEM GYAMMGSGVA SGEDRAEEAA       240
     EMAISSPLLE DIDLSGARGV LVNITAGFDL RLDEFETVGN TIRAFASDNA TVVIGTSLDP       300
     DMNDELRVTV VATGIGMDKR PEITLVTNKQ VQQPVLDRYQ QHGMAPLTQE QKTVAKVVND       360
     NTPQAAKEPD YLDIPAFLRK QAD                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page