(data stored in ACNUC7421 zone)

EMBL: AE006468.HEPA

AE006468.HEPA        Location/Qualifiers
FT   CDS             complement(110002..112908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="STM0096"
FT                   /product="RNA polymerase associated protein"
FT                   /note="putative SNF2 family RNA helicase; similar to E.
FT                   coli probable ATP-dependent RNA helicase (AAC73170.1);
FT                   Blastp hit to AAC73170.1 (968 aa), 93% identity in aa 1 -
FT                   968"
FT                   /db_xref="EnsemblGenomes-Gn:STM0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19060"
FT                   /db_xref="GOA:Q8ZRV8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV8"
FT                   /protein_id="AAL19060.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAMDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHEGWQLHIDEVKEENGLLVYVGTRLDTEETNVTLREVLLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPYSGLRGQRTNLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYTEAQHDAYNPFETEQLVICSLDFARRNKQRLEHLCDAEWDLLVVDE
FT                   AHHLVWSTDAPSREYMAIEQLAERVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFE
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNRLGDLIGEQDIEPLLQAANSDRDDAQAA
FT                   RDELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTVKLPLPTQYQTAIKVSGIMGARK
FT                   SPEDRARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKATTAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   NLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRAIYDSAYASLINYLAAPEETDGFDDLIKSCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQQLAQSIEEQDDDTNLIAFAMNLFDIVGINQDDRGDNLIVLTPSDHMLVPDFPG
FT                   LPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELVYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLSAVNRH
FT                   TGSKLVNAVQQDVHAILQLGETQIEKSARALIDNARREADEKLSGELSRLEALRAVNPN
FT                   IRDDELAAIDSNRQQVLESLNQAGWRLDALRLIVVTHQ"
     MPFTLGQRWI SDTESELGLG TVVAMDARTV TLLFPSTGEN RLYARSDSPV TRVMFNPGDT        60
     ITSHEGWQLH IDEVKEENGL LVYVGTRLDT EETNVTLREV LLDSKLVFSK PQDRLFAGQI       120
     DRMDRFALRY RARKFQSEQY RMPYSGLRGQ RTNLIPHQLN IAHDVGRRHA PRVLLADEVG       180
     LGKTIEAGMI LHQQLLSGAA ERVLIIVPET LQHQWLVEML RRFNLRFALF DDERYTEAQH       240
     DAYNPFETEQ LVICSLDFAR RNKQRLEHLC DAEWDLLVVD EAHHLVWSTD APSREYMAIE       300
     QLAERVPGVL LLTATPEQLG MESHFARLRL LDPNRFHDFE QFVEEQKNYR PVADAVAMLL       360
     AGNKLSNDEL NRLGDLIGEQ DIEPLLQAAN SDRDDAQAAR DELVSMLMDR HGTSRVLFRN       420
     TRNGVKGFPK RELHTVKLPL PTQYQTAIKV SGIMGARKSP EDRARDMLYP EQIYQEFEGD       480
     TGTWWNFDPR VEWLMGYLTS HRSQKVLVIC AKATTALQLE QVLREREGIR AAVFHEGMSI       540
     IERDRAAAWF AEEDTGAQVL LCSEIGSEGR NFQFASNLVM FDLPFNPDLL EQRIGRLDRI       600
     GQAHDIQIHV PYLEKTAQSV LVRWYHEGLD AFEHTCPTGR AIYDSAYASL INYLAAPEET       660
     DGFDDLIKSC REQHEALKAQ LEQGRDRLLE IHSNGGEKAQ QLAQSIEEQD DDTNLIAFAM       720
     NLFDIVGINQ DDRGDNLIVL TPSDHMLVPD FPGLPEDGCT ITFERDVALS REDAQFITWE       780
     HPLIRNGLDL ILSGDTGSST ISLLKNKALP VGTLLVELVY VVEAQAPKQL QLNRFLPPTP       840
     VRMLLDKNGN NLAAQVEFET FNRQLSAVNR HTGSKLVNAV QQDVHAILQL GETQIEKSAR       900
     ALIDNARREA DEKLSGELSR LEALRAVNPN IRDDELAAID SNRQQVLESL NQAGWRLDAL       960
     RLIVVTHQ                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page