(data stored in ACNUC7421 zone)

EMBL: AE006468.HOFB

AE006468.HOFB        Location/Qualifiers
FT   CDS             complement(166319..167704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="STM0143"
FT                   /product="putative integral membrane protein"
FT                   /note="involved in biogenesis of fimbriae (type IV pilin),
FT                   protein transport, DNA uptake; similar to E. coli putative
FT                   integral membrane protein involved in biogenesis of
FT                   fimbriae, protein transport, DNA uptake (AAC73218.1);
FT                   Blastp hit to AAC73218.1 (461 aa), 69% identity in aa 1 -
FT                   459"
FT                   /db_xref="EnsemblGenomes-Gn:STM0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19107"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT3"
FT                   /protein_id="AAL19107.1"
FT                   /translation="MKDAQLNTLCQRHQAVLINSASNSITVAVVDAPSHALLDALHFAT
FT                   QKQIDIVCWTRQQMENHRHKPDQAPSANAAKGGETAAQLLNQTLRSAMAKRASDIHLEP
FT                   GASRYRIRLRIDGVLHILQDIAKETGLALTARLKVLGNLDIAEHRLPQDGQFTVDLAGD
FT                   SISFRIATLPCKEGEKVVLRLLHQVEQTLDLDTLGMYGAQLTAFRQALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTRNTPGINLCSVEDPIEIPLDGINQTQIHPRAGLTFQNVLRALL
FT                   RQDPDIIMVGEIRDGDTAEIAIKAAQTGHLVLSTLHTNSTSETLIRLQQMGVARWMISS
FT                   ALTLVVAQRLVRKLCPHCKQRLSDPVVLSPNLWPSAIPRWQASGCQHCYHGFYGRTALF
FT                   EVLTVTPALRQLIASGASAQALEAHLQQTGTGTLFENGCRAVEQGMTSFEEILCVLGMP
FT                   HER"
     MKDAQLNTLC QRHQAVLINS ASNSITVAVV DAPSHALLDA LHFATQKQID IVCWTRQQME        60
     NHRHKPDQAP SANAAKGGET AAQLLNQTLR SAMAKRASDI HLEPGASRYR IRLRIDGVLH       120
     ILQDIAKETG LALTARLKVL GNLDIAEHRL PQDGQFTVDL AGDSISFRIA TLPCKEGEKV       180
     VLRLLHQVEQ TLDLDTLGMY GAQLTAFRQA LQQPQGLVLV TGPTGSGKTV TLYSALQTRN       240
     TPGINLCSVE DPIEIPLDGI NQTQIHPRAG LTFQNVLRAL LRQDPDIIMV GEIRDGDTAE       300
     IAIKAAQTGH LVLSTLHTNS TSETLIRLQQ MGVARWMISS ALTLVVAQRL VRKLCPHCKQ       360
     RLSDPVVLSP NLWPSAIPRW QASGCQHCYH GFYGRTALFE VLTVTPALRQ LIASGASAQA       420
     LEAHLQQTGT GTLFENGCRA VEQGMTSFEE ILCVLGMPHE R                           461
//

If you have problems or comments...

PBIL Back to PBIL home page