(data stored in ACNUC7421 zone)

EMBL: AE006468.HOFC

AE006468.HOFC        Location/Qualifiers
FT   CDS             complement(165127..166329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="STM0142"
FT                   /product="putative component in type IV pilin biogenesis"
FT                   /note="similar to E. coli putative integral membrane
FT                   protein involved in biogenesis of fimbriae, protein
FT                   transport, DNA uptake (AAC73217.1); Blastp hit to
FT                   AAC73217.1 (400 aa), 67% identity in aa 1 - 400"
FT                   /db_xref="EnsemblGenomes-Gn:STM0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19106"
FT                   /db_xref="GOA:Q8ZRT4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRT4"
FT                   /protein_id="AAL19106.1"
FT                   /translation="MSVKQLWRWQGVNDKGQLEQDVVWADNRLALIITLQHQRIMPLRI
FT                   KRMGVNAALWKEEQSAEIIHQLATLIHAGLTLSEGLELLAKQHPHRQWQALLRTLAHEL
FT                   EQGVPFSSALVSWPQVFPPLYQTMIRTGELTGKLAECCFELARQQKAQRQITVSVKKAL
FT                   RYPAIILTMAALVVFAMLHFVLPEFAAIYRSFNTPLPLLTRGIIAIAQWGSAWGWLILF
FT                   LTMLVAIAHRRVKQKPSWQAQRQRLLLRLPVMGRLIRGQKLAQIFTVLALTQSAGIPFL
FT                   QGLESAIDSLGCPYWSQRLTQVHQEIAAGNPVWLALKNTQEFSPLCLQLVRTGEASGSL
FT                   DIMLHNLARHHSETTLALADNLASLLEPALLIITGLIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MSVKQLWRWQ GVNDKGQLEQ DVVWADNRLA LIITLQHQRI MPLRIKRMGV NAALWKEEQS        60
     AEIIHQLATL IHAGLTLSEG LELLAKQHPH RQWQALLRTL AHELEQGVPF SSALVSWPQV       120
     FPPLYQTMIR TGELTGKLAE CCFELARQQK AQRQITVSVK KALRYPAIIL TMAALVVFAM       180
     LHFVLPEFAA IYRSFNTPLP LLTRGIIAIA QWGSAWGWLI LFLTMLVAIA HRRVKQKPSW       240
     QAQRQRLLLR LPVMGRLIRG QKLAQIFTVL ALTQSAGIPF LQGLESAIDS LGCPYWSQRL       300
     TQVHQEIAAG NPVWLALKNT QEFSPLCLQL VRTGEASGSL DIMLHNLARH HSETTLALAD       360
     NLASLLEPAL LIITGLIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page