(data stored in ACNUC7421 zone)

EMBL: AE006468.HTRA

AE006468.HTRA        Location/Qualifiers
FT   CDS             244493..245920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="STM0209"
FT                   /product="periplasmic serine protease Do, heat shock
FT                   protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="protease DO precursor. (SW:DEGP_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19173"
FT                   /db_xref="GOA:P26982"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26982"
FT                   /protein_id="AAL19173.1"
FT                   /translation="MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPM
FT                   LEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGN
FT                   GGQQQKFMALGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDI
FT                   ALIQIQNPKNLTAIKLADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENY
FT                   ENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
FT                   VEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSL
FT                   NGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIE
FT                   GAEMSNKGQDKGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSV
FT                   LALNIQRGDSSIYLLMQ"
     MKKTTLAMSA LALSLGLALS PLSATAAETS SSAMTAQQMP SLAPMLEKVM PSVVSINVEG        60
     STTVNTPRMP RNFQQFFGDD SPFCQDGSPF QNSPFCQGGG NGGNGGQQQK FMALGSGVII       120
     DAAKGYVVTN NHVVDNASVI KVQLSDGRKF DAKVVGKDPR SDIALIQIQN PKNLTAIKLA       180
     DSDALRVGDY TVAIGNPFGL GETVTSGIVS ALGRSGLNVE NYENFIQTDA AINRGNSGGA       240
     LVNLNGELIG INTAILAPDG GNIGIGFAIP SNMVKNLTSQ MVEYGQVKRG ELGIMGTELN       300
     SELAKAMKVD AQRGAFVSQV MPNSSAAKAG IKAGDVITSL NGKPISSFAA LRAQVGTMPV       360
     GSKISLGLLR EGKAITVNLE LQQSSQSQVD SSTIFSGIEG AEMSNKGQDK GVVVSSVKAN       420
     SPAAQIGLKK GDVIIGANQQ PVKNIAELRK ILDSKPSVLA LNIQRGDSSI YLLMQ            475
//

If you have problems or comments...

PBIL Back to PBIL home page