(data stored in ACNUC7421 zone)

EMBL: AE006468.ILVH

AE006468.ILVH        Location/Qualifiers
FT   CDS             137562..138053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="STM0117"
FT                   /product="acetolactate synthase III, small subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="acetolactate synthase isozyme III small subunit.
FT                   (SW:ILVH_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19081"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="AAL19081.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKRN
FT                   TEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
     MRRILSVLLE NESGALSRVI GLFSQRGYNI ESLTVAPTDD PTLSRMTIQT VGDEKVLEQI        60
     EKQLHKLVDV LRVSELGQGA HVEREIMLVK IQASGYGREE VKRNTEIFRG QIIDVTPTLY       120
     TVQLAGTSDK LDAFLASLRD VAKIVEVARS GVVGLSRGDK IMR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page