(data stored in ACNUC7421 zone)

EMBL: AE006468.ILVI

AE006468.ILVI        Location/Qualifiers
FT   CDS             135898..137559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="STM0116"
FT                   /product="valine sensitive acetolactate synthase III, large
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /note="acetolactate synthase isozyme III large subunit.
FT                   (SW:ILVI_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19080"
FT                   /db_xref="GOA:P40811"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40811"
FT                   /protein_id="AAL19080.1"
FT                   /translation="MFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADGLARATG
FT                   DVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPV
FT                   VKHSFLVKQTEDIPLVLKKAFWLAASGRPGPVVVDLPKDILNPAKKMPYAWPETVSMRS
FT                   YNPTTSGHKGQIKRALQTLASAKKPVVYVGGGAISAACYAPLRHIIETFNLPVVSSLMG
FT                   LGAFPATHRQSLGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATVLH
FT                   IDIDPTSISKTVNADIPVVGDARLVLEQMLELLAQDAPSQPQDDIRDWWQQIESWRARQ
FT                   CLKYDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
FT                   GTMGFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLG
FT                   MVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGLQINRPDELESKLSEALEHVRNN
FT                   RLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
     MFGYPGGAVL DIYDALHTVG GIDHVLVRHE QAAVHMADGL ARATGDVGVV LVTSGPGATN        60
     AITGIATAYM DSIPLVILSG QVATSLIGYD AFQECDMVGI SRPVVKHSFL VKQTEDIPLV       120
     LKKAFWLAAS GRPGPVVVDL PKDILNPAKK MPYAWPETVS MRSYNPTTSG HKGQIKRALQ       180
     TLASAKKPVV YVGGGAISAA CYAPLRHIIE TFNLPVVSSL MGLGAFPATH RQSLGMLGMH       240
     GTYEANMTMH NADVIFAVGV RFDDRTTNNL AKYCPNATVL HIDIDPTSIS KTVNADIPVV       300
     GDARLVLEQM LELLAQDAPS QPQDDIRDWW QQIESWRARQ CLKYDAESES IKPQAVIETL       360
     WRLTKGDAYV TSDVGQHQMF AALYYPFDKP RRWINSGGLG TMGFGLPAAL GVKMALPKEM       420
     VVCVTGDGSI QMNIQELSTA LQYELPVLVL NLNNRYLGMV KQWQDMIYSG RHSQSYMQSL       480
     PDFVRLAEAY GHVGLQINRP DELESKLSEA LEHVRNNRLV FVDVTVDGSE HVYPMQIRGG       540
     GMDEMWLSKT ERT                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page