(data stored in ACNUC7421 zone)

EMBL: AE006468.LEUC

AE006468.LEUC        Location/Qualifiers
FT   CDS             complement(129673..131073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="STM0111"
FT                   /product="3-isopropylmalate isomerase (dehydratase),
FT                   subunit with LeuD"
FT                   /EC_number="4.2.1.33"
FT                   /note="3-isopropylmalate dehydratase large subunit.
FT                   (SW:LEU2_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19075"
FT                   /db_xref="GOA:P15717"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:P15717"
FT                   /protein_id="AAL19075.1"
FT                   /translation="MAKTLYEKLFDAHVVFEAPNETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHHRPVRQPGKTFATMDHNVSTQTKDINASGEMARIQMQELIKNCNEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRALSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGATFDTVVALRA
FT                   EEIAPQVTWGTNPGQVISVTDIIPDPASFSDPVERASAEKALAYMGLQPGVPLTDVAID
FT                   KVFIGSCTNSRIEDLRAAAEVAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRSIK"
     MAKTLYEKLF DAHVVFEAPN ETPLLYIDRH LVHEVTSPQA FDGLRAHHRP VRQPGKTFAT        60
     MDHNVSTQTK DINASGEMAR IQMQELIKNC NEFGVELYDL NHPYQGIVHV MGPEQGVTLP       120
     GMTIVCGDSH TATHGAFGAL AFGIGTSEVE HVLATQTLKQ GRAKTMKIEV TGNAAPGITA       180
     KDIVLAIIGK TGSAGGTGHV VEFCGDAIRA LSMEGRMTLC NMAIEMGAKA GLVAPDETTF       240
     NYVKGRLHAP KGRDFDEAVE YWKTLKTDDG ATFDTVVALR AEEIAPQVTW GTNPGQVISV       300
     TDIIPDPASF SDPVERASAE KALAYMGLQP GVPLTDVAID KVFIGSCTNS RIEDLRAAAE       360
     VAKGRKVAPG VQALVVPGSG PVKAQAEAEG LDKIFIEAGF EWRLPGCSMC LAMNNDRLNP       420
     GERCASTSNR NFEGRQGRGG RTHLVSPAMA AAAAVTGHFA DIRSIK                      466
//

If you have problems or comments...

PBIL Back to PBIL home page