(data stored in ACNUC7421 zone)

EMBL: AE006468.MOD

AE006468.MOD         Location/Qualifiers
FT   CDS             403332..405290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mod"
FT                   /locus_tag="STM0357"
FT                   /product="DNA methylase; restriction system"
FT                   /note="type iii restriction-modification system stylti
FT                   enzyme mod (stylti methyltransferase) (SW:T3MO_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19311"
FT                   /db_xref="GOA:P40814"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041405"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40814"
FT                   /protein_id="AAL19311.1"
FT                   /translation="MLKDNQKHNESVAPNSAFLSELQRALPEFFTADRYNEQGELIAKG
FT                   GFDLARFERALKARNIDELTSGYQIDFIGKDYAKKQAGEKSVTVIVPDVEHNTLAENKN
FT                   SHNLFLTGDNLDVLRHLQNNYADTVDMIYIDPPYNTGSDGFVYPDHFEYSDRALQDMFG
FT                   LNDTELARLKSIQGKSTHSAWLSFMYPRLFLARKLLKDTGFIFISIDDNEYANLKLMMD
FT                   EIFGEGGFVTNVMWKRKKEISNDSDNVSIQGEYILVYAKTGQGALRLEPLSKEYIQKSY
FT                   KEPTEQFPEGKWRPVPLTVSKGLSGGGYTYKITTPNGTVHERLWAYPEASYQKLVADNL
FT                   VYFGKDNGGIPQRVMYAHHSKGQPTTNYWDNVASNKEGKKEILDLFGDNVFDTPKPTAL
FT                   LKKIIKLAIDKDGVVLDFFAGSGTTAHAVMALNEEDGGQRTFILCTIDQALSNNTIAKK
FT                   AGYNTIDEISRERITRVAAKIRANNPATNSDLGFKHYRFATPTQQTLDDLDSFDIATGH
FT                   FINTSGQLAAFTESGFTDMINPFSARGLGVPGGASGEETLLTTWLVADGYKMDIDVQTV
FT                   DFSGYCARYVDNTRLYLIDERWGTEQTRDLLNHIGTHQLPVQTIVIYGYSFDLESIREL
FT                   EIGLKQLDQKVNLVKRY"
     MLKDNQKHNE SVAPNSAFLS ELQRALPEFF TADRYNEQGE LIAKGGFDLA RFERALKARN        60
     IDELTSGYQI DFIGKDYAKK QAGEKSVTVI VPDVEHNTLA ENKNSHNLFL TGDNLDVLRH       120
     LQNNYADTVD MIYIDPPYNT GSDGFVYPDH FEYSDRALQD MFGLNDTELA RLKSIQGKST       180
     HSAWLSFMYP RLFLARKLLK DTGFIFISID DNEYANLKLM MDEIFGEGGF VTNVMWKRKK       240
     EISNDSDNVS IQGEYILVYA KTGQGALRLE PLSKEYIQKS YKEPTEQFPE GKWRPVPLTV       300
     SKGLSGGGYT YKITTPNGTV HERLWAYPEA SYQKLVADNL VYFGKDNGGI PQRVMYAHHS       360
     KGQPTTNYWD NVASNKEGKK EILDLFGDNV FDTPKPTALL KKIIKLAIDK DGVVLDFFAG       420
     SGTTAHAVMA LNEEDGGQRT FILCTIDQAL SNNTIAKKAG YNTIDEISRE RITRVAAKIR       480
     ANNPATNSDL GFKHYRFATP TQQTLDDLDS FDIATGHFIN TSGQLAAFTE SGFTDMINPF       540
     SARGLGVPGG ASGEETLLTT WLVADGYKMD IDVQTVDFSG YCARYVDNTR LYLIDERWGT       600
     EQTRDLLNHI GTHQLPVQTI VIYGYSFDLE SIRELEIGLK QLDQKVNLVK RY               652
//

If you have problems or comments...

PBIL Back to PBIL home page