(data stored in ACNUC7421 zone)

EMBL: AE006468.MURE

AE006468.MURE        Location/Qualifiers
FT   CDS             143479..144966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="STM0123"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate
FT                   2,6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="similar to E. coli meso-diaminopimelate-adding
FT                   enzyme (AAC73196.1); Blastp hit to AAC73196.1 (495 aa), 91%
FT                   identity in aa 1 - 495"
FT                   /db_xref="EnsemblGenomes-Gn:STM0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19087"
FT                   /db_xref="GOA:Q8ZRU7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU7"
FT                   /protein_id="AAL19087.1"
FT                   /translation="MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVAAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHE
FT                   PSENMRLVAVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHVLASLVAQGATFGAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYE
FT                   AAKWMLYSTHHHGQAIVNADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEY
FT                   HDRGATIRFASSWGEGEIESRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADIVVVTDDNPRTEEPRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDN
FT                   DVVLIAGKGHEDYQIVGTQRLDYSDRVTAARLLGVIA"
     MADRNLRDLL APWVAGLPAR ELREMTLDSR VAAAGDLFVA VVGHQADGRR YIPQAIAQGV        60
     AAIIAEAKDE ASDGEIREMH GVPVVYLSQL NERLSALAGR FYHEPSENMR LVAVTGTNGK       120
     TTTTQLLAQW SQLLGETSAV MGTVGNGLLG KVIPTENTTG SAVDVQHVLA SLVAQGATFG       180
     AMEVSSHGLV QHRVAALKFA ASVFTNLSRD HLDYHGDMAH YEAAKWMLYS THHHGQAIVN       240
     ADDEVGRRWL ASLPDAVAVS MEGHINPNCH GRWLKAEAVE YHDRGATIRF ASSWGEGEIE       300
     SRLMGAFNVS NLLLALATLL ALGYPLTDLL KTAARLQPVC GRMEVFTAPG KPTVVVDYAH       360
     TPDALEKALQ AARLHCAGKL WCVFGCGGDR DKGKRPLMGA IAEEFADIVV VTDDNPRTEE       420
     PRAIINDILA GMLDAGQVRV MEGRAEAVTN AIMQAKDNDV VLIAGKGHED YQIVGTQRLD       480
     YSDRVTAARL LGVIA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page