(data stored in ACNUC7421 zone)

EMBL: AE006468.PDXA

AE006468.PDXA        Location/Qualifiers
FT   CDS             complement(103481..104470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="STM0091"
FT                   /product="NAD-dependent dehydrogenase/carboxylase"
FT                   /note="pyridoxine phosphate biosynthetic protein PdxJ-PdxA
FT                   subunit; similar to E. coli pyridoxine biosynthesis
FT                   (AAC73163.1); Blastp hit to AAC73163.1 (329 aa), 92%
FT                   identity in aa 1 - 329"
FT                   /db_xref="EnsemblGenomes-Gn:STM0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19055"
FT                   /db_xref="GOA:P58717"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="PDB:1R8K"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58717"
FT                   /protein_id="AAL19055.1"
FT                   /translation="MSSAQRVVITPGEPAGSGPDLVVQLAQRAWPIELVVCADGALLTE
FT                   RAAMLGLPLSLLPYSPDVPAAPQPAGTLTLLPVSLRAPAISGQLTVENGPYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGISFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRAIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ"
     MSSAQRVVIT PGEPAGSGPD LVVQLAQRAW PIELVVCADG ALLTERAAML GLPLSLLPYS        60
     PDVPAAPQPA GTLTLLPVSL RAPAISGQLT VENGPYVVET LARACDGCLN GEFAALITGP       120
     VHKGVINDAG ISFTGHTEFF EERSQAKKVV MMLATEELRV ALATTHLPLR AIADAITPAL       180
     LHEVIAILHH DLRTKFGIAE PRILVCGLNP HAGEGGHMGT EEIDTIIPVL DELRAQGMKL       240
     NGPLPADTLF QPKYLDNADA VLAMYHDQGL PVLKYQGFGR GVNITLGLPF IRTSVDHGTA       300
     LELAGRGKAD VGSFITALNL AIKMIVNTQ                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page