(data stored in ACNUC7421 zone)

EMBL: AE006468.PE149

AE006468.PE149       Location/Qualifiers
FT   CDS             complement(171810..173216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0149"
FT                   /product="putative permease of the Na+:galactoside
FT                   symporter family"
FT                   /note="hypothetical protein (gi|7688349)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19113"
FT                   /db_xref="GOA:H9L454"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:H9L454"
FT                   /protein_id="AAL19113.1"
FT                   /translation="MDKGRLSVREKIGYGMGDAGCNIIFGAIMLFVNYFYTDIFGLAPA
FT                   LVGVLLLSVRVIDAVTDPVMGALADRTQSKYGRFRPWLLWIAFPYALFSVLMFTTPDWG
FT                   YNSKVVYAFVTYFLLSVTYTAINIPYCSLGGVITNDPKERVACQAYRFVLVGIATLLLS
FT                   LTLLPMVDWFGGGDKAKGYQLAMTVLAIIGMGMFLFCFASVRERVRPAVPTHDDMKNDF
FT                   KDVWKNDQWVRILLLTLCNVCPGFIRMAATMYYVTWVMGQSTHFATLFISLGVVGMMIG
FT                   SMLAKVLTDRWCKLKVFFWTNIALAIFSCAFYFFDPKATVMIVALYFLLNILHQIPSPL
FT                   HWSLMADVDDYGEWKTGKRITGISFSGNLFFLKLGLAIAGAMVGFLLSWYGYDASAKAQ
FT                   SASAMNGIMLLFTVIPGVGYLITAGVVRLLKVDRELMKKIQDDLEKRRTNYRELSELQE
FT                   LNAAESVRKA"
     MDKGRLSVRE KIGYGMGDAG CNIIFGAIML FVNYFYTDIF GLAPALVGVL LLSVRVIDAV        60
     TDPVMGALAD RTQSKYGRFR PWLLWIAFPY ALFSVLMFTT PDWGYNSKVV YAFVTYFLLS       120
     VTYTAINIPY CSLGGVITND PKERVACQAY RFVLVGIATL LLSLTLLPMV DWFGGGDKAK       180
     GYQLAMTVLA IIGMGMFLFC FASVRERVRP AVPTHDDMKN DFKDVWKNDQ WVRILLLTLC       240
     NVCPGFIRMA ATMYYVTWVM GQSTHFATLF ISLGVVGMMI GSMLAKVLTD RWCKLKVFFW       300
     TNIALAIFSC AFYFFDPKAT VMIVALYFLL NILHQIPSPL HWSLMADVDD YGEWKTGKRI       360
     TGISFSGNLF FLKLGLAIAG AMVGFLLSWY GYDASAKAQS ASAMNGIMLL FTVIPGVGYL       420
     ITAGVVRLLK VDRELMKKIQ DDLEKRRTNY RELSELQELN AAESVRKA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page