(data stored in ACNUC7421 zone)

EMBL: AE006468.PE155

AE006468.PE155       Location/Qualifiers
FT   CDS             182720..183004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0155"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR75"
FT                   /protein_id="AAL19119.1"
FT                   /translation="MKLFLTTAALTATLISGMAFASDPVIPWATNSGGTESTHIAAMGE
FT                   DLNAQHQQITHTHEGVWAANSGSIQADEAALTSNKPPVQGHPELMPHQG"
     MKLFLTTAAL TATLISGMAF ASDPVIPWAT NSGGTESTHI AAMGEDLNAQ HQQITHTHEG        60
     VWAANSGSIQ ADEAALTSNK PPVQGHPELM PHQG                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page