(data stored in ACNUC7421 zone)

EMBL: AE006468.PE16

AE006468.PE16        Location/Qualifiers
FT   CDS             complement(16493..17026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18980"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS11"
FT                   /protein_id="AAL18980.1"
FT                   /translation="MNPIIDGIIALEGGYVFNPKDKGGATHWGITEATARAHGYAGDMR
FT                   DLTHAEAYAILEEDYWIKPGFDVISTLSWPVSFELCDAAVNIGAYHPSAWLQRWLNVFN
FT                   HEGKRYPDIHVDGNIGPRTLAALEHYLAWRGQEGEAVLVKALNCSQGTYYLNVAEKNHN
FT                   NEQFIYGWIKNRVT"
     MNPIIDGIIA LEGGYVFNPK DKGGATHWGI TEATARAHGY AGDMRDLTHA EAYAILEEDY        60
     WIKPGFDVIS TLSWPVSFEL CDAAVNIGAY HPSAWLQRWL NVFNHEGKRY PDIHVDGNIG       120
     PRTLAALEHY LAWRGQEGEA VLVKALNCSQ GTYYLNVAEK NHNNEQFIYG WIKNRVT          177
//

If you have problems or comments...

PBIL Back to PBIL home page