(data stored in ACNUC7421 zone)

EMBL: AE006468.PE20

AE006468.PE20        Location/Qualifiers
FT   CDS             23335..24039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0020"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73478.1); Blastp hit to AAC73478.1 (222 aa), 32%
FT                   identity in aa 21 - 222"
FT                   /db_xref="EnsemblGenomes-Gn:STM0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18984"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS07"
FT                   /protein_id="AAL18984.1"
FT                   /translation="MKKMMNDAFAKDNNENSLHSFLFSQQAKPHAAIDALFSALLPFGQ
FT                   PFTLGIGDEFYLQANDEHYIVLLESGVVSFCHDDKRLHISSSFAPSVVGMVDSYGATYN
FT                   VPARPEHFLLAETVCTGRFVRLPDFIKIADECDLWHDVARCLAYRLMVMSARDRELVGV
FT                   DSYLKVRALLTEIWAYPQAYRESIIVLNFIQRRTGISRSRTMKILSELKKGGYIHIDNG
FT                   RLTALGKLPVAY"
     MKKMMNDAFA KDNNENSLHS FLFSQQAKPH AAIDALFSAL LPFGQPFTLG IGDEFYLQAN        60
     DEHYIVLLES GVVSFCHDDK RLHISSSFAP SVVGMVDSYG ATYNVPARPE HFLLAETVCT       120
     GRFVRLPDFI KIADECDLWH DVARCLAYRL MVMSARDREL VGVDSYLKVR ALLTEIWAYP       180
     QAYRESIIVL NFIQRRTGIS RSRTMKILSE LKKGGYIHID NGRLTALGKL PVAY             234
//

If you have problems or comments...

PBIL Back to PBIL home page