(data stored in ACNUC7421 zone)

EMBL: AE006468.PE201

AE006468.PE201       Location/Qualifiers
FT   CDS             236265..237104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0201"
FT                   /product="putative outer membrane protein"
FT                   /note="hypothetical 30.2 da protein in stfG 3'region
FT                   precursor. (SW:YADU_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19165"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87663"
FT                   /protein_id="AAL19165.1"
FT                   /translation="MKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDKS
FT                   IVAEVTIATPEGVYYGSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACKN
FT                   LPSNWRGCGSFTLEITVQSDDYGCPWLASSHIVATTFITNETYSPPDTRSSVCPKVPVD
FT                   TFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSSG
FT                   ITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
     MKIIRTLFLL LIAVYGSSVV AKPMLKATFS STTMYYGIGP NSDKSIVAEV TIATPEGVYY        60
     GSWNLSGHRK GETLTADSWS GPEPAPKVVL KDFDNTVSRS ACKNLPSNWR GCGSFTLEIT       120
     VQSDDYGCPW LASSHIVATT FITNETYSPP DTRSSVCPKV PVDTFDISWD ANVSKQKTTL       180
     MLDATGGTVN RTLHTYLMEG GKLCDGSKFD NRGAYCRFVS SGITLNVLGC DQSSVTTSAV       240
     DHPITDVELH DINVAVNTRN IGSGQFTSTC SFQYIIDEL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page