(data stored in ACNUC7421 zone)

EMBL: AE006468.PE250

AE006468.PE250       Location/Qualifiers
FT   CDS             296913..298088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0257"
FT                   /product="putative drug efflux protein (perhaps for
FT                   chloramphenicol)"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74729.1); Blastp hit to AAC74729.1 (389 aa), 41%
FT                   identity in aa 7 - 378"
FT                   /db_xref="EnsemblGenomes-Gn:STM0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19214"
FT                   /db_xref="GOA:Q8ZRM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM5"
FT                   /protein_id="AAL19214.1"
FT                   /translation="MPLALFALTISAFAIGTTEFVIVGLVPTIAQQLAISLPSAGMLVS
FT                   IYALGVAIGAPVLTALTGRLPRKQLLVALMVLFTAGNLLAWQAPGYMTLIVARLLTGLA
FT                   HGVFFSIGSTIATSLVPKEKAASAIAIMFGGLTVALVTGVPLGTFIGQHFGWRETFLAV
FT                   SLLGVIALMSSQLLIPANIPGRAAASIRDQVKVLTHPRLLLIYAVTALGYGGVFTAFTF
FT                   LAPMMQDLAGFSPAAVSWILLGYGVSVAIGNIWGGKLADKHGAVPALKFIFAALFVLLM
FT                   VFQVTASTQYAALATILVMGVFAFGNVPGLQVYVVQKAEQFTPNAVDVASGLNIAAFNI
FT                   GIALGSVIGGQTVEHYGLAQTPWIGALIVLVAFLLMGVSGRLDKPVRIALE"
     MPLALFALTI SAFAIGTTEF VIVGLVPTIA QQLAISLPSA GMLVSIYALG VAIGAPVLTA        60
     LTGRLPRKQL LVALMVLFTA GNLLAWQAPG YMTLIVARLL TGLAHGVFFS IGSTIATSLV       120
     PKEKAASAIA IMFGGLTVAL VTGVPLGTFI GQHFGWRETF LAVSLLGVIA LMSSQLLIPA       180
     NIPGRAAASI RDQVKVLTHP RLLLIYAVTA LGYGGVFTAF TFLAPMMQDL AGFSPAAVSW       240
     ILLGYGVSVA IGNIWGGKLA DKHGAVPALK FIFAALFVLL MVFQVTASTQ YAALATILVM       300
     GVFAFGNVPG LQVYVVQKAE QFTPNAVDVA SGLNIAAFNI GIALGSVIGG QTVEHYGLAQ       360
     TPWIGALIVL VAFLLMGVSG RLDKPVRIAL E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page