(data stored in ACNUC7421 zone)

EMBL: AE006468.PE259

AE006468.PE259       Location/Qualifiers
FT   CDS             complement(305732..306727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0267"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19223"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM0"
FT                   /protein_id="AAL19223.1"
FT                   /translation="MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFR
FT                   LGQTPTMTFAPREIAQVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPT
FT                   LVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLS
FT                   DHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQS
FT                   SVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCW
FT                   EIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH"
     MTGALNQAQK TPWRYGFLNL MRRVDAQLCD TPAGSIWQPR MEKFRLGQTP TMTFAPREIA        60
     QVSWQDGRLH LSLYSLGLWG PNGPLPLHYT ELALNRSESR HDPTLVHFSN IFHHRWLTQF       120
     WQAWRSAQSA GGGLDKPEHD RFAFYIASLS GQDLRESAES PLSDHVRLAA SAHLVRESRN       180
     PDGLAATLAH YFSVPFAVKE FALHWITVAN DEITRLGTPA QSSVLGNGAL IGQAVPDMQY       240
     KFRLIIGPLT LEDYLRFLPG GNNLPVLTEL VRTFIGFEYC WEIELQLKPH AAPPAVIGGA       300
     QRLGWTAWAG KAMHDRPVTG MIFEPEHGLT H                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page