(data stored in ACNUC7421 zone)

EMBL: AE006468.PE260

AE006468.PE260       Location/Qualifiers
FT   CDS             complement(306724..308607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0268"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19224"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL9"
FT                   /protein_id="AAL19224.1"
FT                   /translation="MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPY
FT                   VERMIEAFSFLSARTQLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDL
FT                   AKGVTVPRDTAFVSPIPEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLP
FT                   PNIHVAGALRITLRTFGELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGE
FT                   PGHFDGELNVNLQHPVAHEGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGL
FT                   SAGLQKVQGNVAEIVILLNRLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSV
FT                   TEQHLVVDRTRPLDYEVFSVQEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRRE
FT                   PRRSSENARRYGTRTPYTGSEVFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRN
FT                   GRDDLTVDAAIPVAGVGLIRPPRPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQ
FT                   ALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGF
FT                   SGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGHVMTWPVRTGQRGSV"
     MDPRLLEYYN RELSYLRETG AEFATLHPKI AARLGMQGTD IADPYVERMI EAFSFLSART        60
     QLKIDAEFPR FTQRLLEVVS PNYVTPTPSM AVVKLYPDTQ EGDLAKGVTV PRDTAFVSPI       120
     PEGENTACQF RSSQDVTLWP LSIEEVRLTA APPDMPALHR YLPPNIHVAG ALRITLRTFG       180
     ELTFSELAGP ARLPFYLCGE ERIASHLFEL LHTSAVATLA GEPGHFDGEL NVNLQHPVAH       240
     EGLEPGQGLL PLAWNVFHGH NLLHEFFACP ERFYFFTPTG LSAGLQKVQG NVAEIVILLN       300
     RLPPDWLIHQ TDAAQFSLFC TPVINLFPRT TTRIEVTHSV TEQHLVVDRT RPLDYEVFSV       360
     QEVEGLEAET TRKMIFRPLY HTRNNDEGNH GRYFSLRREP RRSSENARRY GTRTPYTGSE       420
     VFLSLVDQHE APYPENLRHI TVTAMVTNRD LPCLIPRNGR DDLTVDAAIP VAGVGLIRPP       480
     RPPQPPLAER EMAWRLIRQL SFNYLPLADL DHRTGGQALR DLLNLFIPAH DSPQSRQVRS       540
     LIGCKTTPVT RRLPGSGLLV YGRGVSCELT VDEEGFSGIS PYLFGLVLEH YIARHVSINT       600
     FSQMTLHSMQ RGHVMTWPVR TGQRGSV                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page