(data stored in ACNUC7421 zone)

EMBL: AE006468.PE262

AE006468.PE262       Location/Qualifiers
FT   CDS             complement(309114..309938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0270"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19226"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL8"
FT                   /protein_id="AAL19226.1"
FT                   /translation="MKKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLF
FT                   QLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELVRCEMFRHTVFQGEQRPGFLLPQ
FT                   PVWVESLLAALACHDDTGEVDKHRNTALEAITDTGGQWNGGAFDWASDSDSRLGPVLEL
FT                   VTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWLFTRYSGSESASD
FT                   ALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAHCTFHAQENDGA"
     MKKTDTLPAT LSALIQEYSI AEGIQMAEQQ VRENPAKALC RHSLFQLLCV AGDWSRALHQ        60
     LQLCARMEAN YTQEARLYRE LVRCEMFRHT VFQGEQRPGF LLPQPVWVES LLAALACHDD       120
     TGEVDKHRNT ALEAITDTGG QWNGGAFDWA SDSDSRLGPV LELVTGGVYI WLPFSQIRSL       180
     ESPQPTRLTD LLWKPVNITL VNGDTHGAWL FTRYSGSESA SDALRLCRET AWQDGPGETT       240
     VRALGQKVWL TSHGDISLLD MAHCTFHAQE NDGA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page