(data stored in ACNUC7421 zone)

EMBL: AE006468.PE270

AE006468.PE270       Location/Qualifiers
FT   CDS             317684..318169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0277"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19234"
FT                   /db_xref="InterPro:IPR025562"
FT                   /db_xref="PDB:4HFF"
FT                   /db_xref="PDB:4J30"
FT                   /db_xref="PDB:4J32"
FT                   /db_xref="PDB:4JUR"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IS4"
FT                   /protein_id="AAL19234.1"
FT                   /translation="MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACP
FT                   IRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQS
FT                   DFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVGTLWILP"
     MNRPSFNEAW LAFRKVNHSV ADVGSIIGGN VGKNITGGYF QNACPIRMSY VLNATGFPIA        60
     RNSPYAKVSG ADNKFYIYRV NDMIDYLTHT MGKPDLIVNN PKQSDFIGKK GIIVVKGHGW       120
     SNARGHVTLW NGSICSDQCH LLNDPDNGPF VPEVGTLWIL P                           161
//

If you have problems or comments...

PBIL Back to PBIL home page