(data stored in ACNUC7421 zone)

EMBL: AE006468.PE276

AE006468.PE276       Location/Qualifiers
FT   CDS             322421..323194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0283"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19240"
FT                   /db_xref="GOA:Q93IR9"
FT                   /db_xref="InterPro:IPR041238"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR9"
FT                   /protein_id="AAL19240.1"
FT                   /translation="MMKKSTYDVSHHSAVCGVTGDYYRISATYHITRSVRVFLIILCCL
FT                   LSGGAFAGSPINAGFISPDNVNLSTQDFLKFYATDNVQKKDNALMYMLGVEDATEGKAW
FT                   CGYGQVDSITINHTVLTWFEQHAVKKPDVRASILIEEALVKNFPCQRTDSSIKIASRSS
FT                   PILSLTPDALNLSGNDFFKFWVSGNQRDKLRAGVYLLGVEDATENKLWCGYALFKTLTL
FT                   NELVYVSLKNKTNEELNSRAAELIINKLIEYPCNI"
     MMKKSTYDVS HHSAVCGVTG DYYRISATYH ITRSVRVFLI ILCCLLSGGA FAGSPINAGF        60
     ISPDNVNLST QDFLKFYATD NVQKKDNALM YMLGVEDATE GKAWCGYGQV DSITINHTVL       120
     TWFEQHAVKK PDVRASILIE EALVKNFPCQ RTDSSIKIAS RSSPILSLTP DALNLSGNDF       180
     FKFWVSGNQR DKLRAGVYLL GVEDATENKL WCGYALFKTL TLNELVYVSL KNKTNEELNS       240
     RAAELIINKL IEYPCNI                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page