(data stored in ACNUC7421 zone)

EMBL: AE006468.PE278

AE006468.PE278       Location/Qualifiers
FT   CDS             323862..327731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0285"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19242"
FT                   /db_xref="GOA:Q8ZRL2"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL2"
FT                   /protein_id="AAL19242.1"
FT                   /translation="MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVG
FT                   SRVVTIALLLMLLVLWLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLI
FT                   GFILLMYALYGLYRLWRALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIR
FT                   QLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTS
FT                   RILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKH
FT                   RPGAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDL
FT                   LPGFSEYFRTLTSHLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDT
FT                   RLQEEYDLKSRQRLYTFPREFAALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAA
FT                   QAQADAVADQLSIWQRFVRAIKTARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHL
FT                   VEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISARATRLDGDVK
FT                   AYTGKPAMAPVPALLDSARELSAWPELDPDAPPLAWRYGLYSVPPVTDSVASLYNRLLD
FT                   QLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVIND
FT                   LGNSDSVAGFGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYA
FT                   RALAAMESEAPQEFTLVRAVGADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPE
FT                   FVAAATANDGWVMGRESTPKKLTDSLRSQIPGQEQSVAREVRRLYLTEYARRWQDFLDS
FT                   IHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQTTLVPPPDPQARQKQLA
FT                   QRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQSGGGTMQIA
FT                   SLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTR
FT                   KINAGTGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWS
FT                   KQLAPLADTASDPWRYKPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQIS
FT                   VVDMDPAIMELVIDIDGQVLRYAHGPDRPLKVTWPGPRNGSMAEITASPRIRQDTSTLL
FT                   TGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVVLEITAGRDFNPVSRELLQNFSC
FT                   PARAL"
     MQKFLSLLFS RRALAVVGVL VLALLVWFVG PLVSFDTLRP LASVGSRVVT IALLLMLLVL        60
     WLVNWSMSII GISVLCLAIG FVTPLLALGD VHPFAPLWVR LTLIGFILLM YALYGLYRLW       120
     RALRMDEQLL RRFLHPRGEE VPVAGEIKAD LRTVNHIVTQ AIRQLRQLRV DMPGWRKIFE       180
     GKRFLYELPW FMVVGSPGDG KTTALLNTGL QFPLAEQMEQ TSRILTVPGG GTLHCDWWFT       240
     NEAVLIDTAG RYARHDDGGE ASAAQRNAGE WQGFLGLLRK HRPGAPLNGV ILTLNVADLT       300
     AQSPAERLAA CAALRARLAE LRETLGIRFP VYLVVTKMDL LPGFSEYFRT LTSHLRAQIW       360
     GFTLPYSRRR KAGDPQALHA ACAQELARLT LRLDQGLDTR LQEEYDLKSR QRLYTFPREF       420
     AALGEPLLEA IEQIFLDSKF DATQLNNTLR GVFFTSAAQA QADAVADQLS IWQRFVRAIK       480
     TARGESSASL PHALPDGNRS YFLHDLLTQF IFREAHLVEP NLQWAWRYRL LRLGGHLLVL       540
     VLAFLLWQGM QTSQQTNGDY LNEISARATR LDGDVKAYTG KPAMAPVPAL LDSARELSAW       600
     PELDPDAPPL AWRYGLYSVP PVTDSVASLY NRLLDQLLLP PLVKRMEYVL ADAIARQDSK       660
     AAYDALRIYL LLNLDKDHED KYNAAEIQSW VINDLGNSDS VAGFGGRAAV LTHIEALFDG       720
     SRVVHSPYEK DEALIRQARA FLDGHTSTER IYARALAAME SEAPQEFTLV RAVGADAGTV       780
     FVRSNGAPLD RGVPGIFTRE GYRELFDKRL PEFVAAATAN DGWVMGREST PKKLTDSLRS       840
     QIPGQEQSVA REVRRLYLTE YARRWQDFLD SIHSINSAGE EGSSGLAYDL QVLRTLASPD       900
     SPLMRLGKAV VEQTTLVPPP DPQARQKQLA QRASGNAGKV VQTAKLFQDI HPEERLEKTL       960
     VDDRFAALRE VIAGRTDGGQ SGGGTMQIAS LLTMLNEYYT QLTIADSALA AGTLPARITA      1020
     ADKLQLEAAK LPAPLKNILL DLTKQGTRKI NAGTGDVLNT QMEAMMGDDC RDAIDGRYPF      1080
     ADSPQEVSAE DFNRIFASGG VLDAFWSKQL APLADTASDP WRYKPTEGNM TLQGPDLTPF      1140
     QQAKQIRSVF FNSEGGKKFS WSMQISVVDM DPAIMELVID IDGQVLRYAH GPDRPLKVTW      1200
     PGPRNGSMAE ITASPRIRQD TSTLLTGGPW ALFHLLDAGM VQETAVRGRQ LVEYDFDGRR      1260
     VVLEITAGRD FNPVSRELLQ NFSCPARAL                                        1289
//

If you have problems or comments...

PBIL Back to PBIL home page