(data stored in ACNUC7421 zone)

EMBL: AE006468.PE280

AE006468.PE280       Location/Qualifiers
FT   CDS             328516..328932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0287"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19244"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR5"
FT                   /protein_id="AAL19244.1"
FT                   /translation="MKKYAVEVLFMSACAGMFLPVFAWGGTDVNIDNPLAECVDIHPVH
FT                   RQEMDNLTILKTTVTLKKSTGECGCFSTLINYTSLLAQDVEGYGRGSAYSLQEGNISLA
FT                   KMQGRYPFSFVLSVDNQSVRDQKLALMIRCTPPL"
     MKKYAVEVLF MSACAGMFLP VFAWGGTDVN IDNPLAECVD IHPVHRQEMD NLTILKTTVT        60
     LKKSTGECGC FSTLINYTSL LAQDVEGYGR GSAYSLQEGN ISLAKMQGRY PFSFVLSVDN       120
     QSVRDQKLAL MIRCTPPL                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page