(data stored in ACNUC7421 zone)

EMBL: AE006468.PE281

AE006468.PE281       Location/Qualifiers
FT   CDS             328956..329477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0288"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19245"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IR4"
FT                   /protein_id="AAL19245.1"
FT                   /translation="MMAVRLTFDGQKLTWPGIGIFKATTGLPDLQWPDKQCVPDAAIPE
FT                   GNYKLFIQFQGEAPIRNAADCDLGPSWGWSTIPRGQAAGTCEIYWANWGYNRIRLESAD
FT                   EKTRKACGGKRGGFYIHDSTKGYSHGCIEVEPVFFRILKQETEKENGEKTFTVNVKYVS
FT                   GQQTNGGTKQ"
     MMAVRLTFDG QKLTWPGIGI FKATTGLPDL QWPDKQCVPD AAIPEGNYKL FIQFQGEAPI        60
     RNAADCDLGP SWGWSTIPRG QAAGTCEIYW ANWGYNRIRL ESADEKTRKA CGGKRGGFYI       120
     HDSTKGYSHG CIEVEPVFFR ILKQETEKEN GEKTFTVNVK YVSGQQTNGG TKQ              173
//

If you have problems or comments...

PBIL Back to PBIL home page