(data stored in ACNUC7421 zone)

EMBL: AE006468.PE283

AE006468.PE283       Location/Qualifiers
FT   CDS             332087..332533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0290"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19247"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR57"
FT                   /protein_id="AAL19247.1"
FT                   /translation="MDRPYRIQEGCFVLPETFTDRSVNIFILEGNERTSPSLNISRDTL
FT                   KPDEDLPAYIDRQIALMKKNLGQHRVLSRAPAQAGTGNDALMGEQIAATHKSGKTEVYQ
FT                   RQAGFIATPGKVLVFTLTSPRPFDDKADLLWNTWLAGFQPDKNE"
     MDRPYRIQEG CFVLPETFTD RSVNIFILEG NERTSPSLNI SRDTLKPDED LPAYIDRQIA        60
     LMKKNLGQHR VLSRAPAQAG TGNDALMGEQ IAATHKSGKT EVYQRQAGFI ATPGKVLVFT       120
     LTSPRPFDDK ADLLWNTWLA GFQPDKNE                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page