(data stored in ACNUC7421 zone)

EMBL: AE006468.PE284

AE006468.PE284       Location/Qualifiers
FT   CDS             332552..336646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0291"
FT                   /product="putative RHS-family protein"
FT                   /note="similar to E. coli rhsD protein in rhs element
FT                   (AAC73599.1); Blastp hit to AAC73599.1 (1426 aa), 27%
FT                   identity in aa 315 - 985, 46% identity in aa 1151 - 1261,
FT                   25% identity in aa 297 - 788, 24% identity in aa 346 - 870,
FT                   22-1073758628dentity in aa 465 - 904, 26% identity in aa
FT                   317 - 724, 32-1073758654dentity in aa 4 - 143, 24% identity
FT                   in aa 232 - 605, 21% identity in aa 562 - 970, 23% identity
FT                   in aa 318 - 755, 32% identity in aa 974 - 1076, 26%
FT                   identity in aa 935 - 1051, 22% identity in aa 358 - 540,
FT                   37% identity in aa 1 - 32, 31-1073758588dentity in aa 1041
FT                   - 1099, 26% identity in aa 1000 - 1083,
FT                   30-1073758532dentity in aa 943 - 1025, 27% identity in aa
FT                   1172 - 1193, 32% identity in aa 1211 - 1235, 63% identity
FT                   in aa 1393 - 1403, 28% identity in aa 1175 - 1210"
FT                   /db_xref="EnsemblGenomes-Gn:STM0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19248"
FT                   /db_xref="GOA:Q8ZRL0"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRL0"
FT                   /protein_id="AAL19248.1"
FT                   /translation="MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLA
FT                   GLILGFMADQIASGVLQLGEAIGRSIHHTAGKILTGSENVSTNSRPAARAVLSTVKCDN
FT                   HIAEKRIAQGSENIYINSQPAARKDDHTECDAVIEDGSPNVFLGGGTQTVLEISSEIPD
FT                   WLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELVGMAVGEAISGLF
FT                   SNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDDD
FT                   EHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFD
FT                   SDGMAYLLFMETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQG
FT                   GTRGNLVEYRYDDNGQLTGVVNRAGTQVRQFAYENGLMTAHSNATGFTCRYRWQELDGA
FT                   PRVTEHDTSDGEHYRFDYDFAAGTTTVTGRQGETWQWWYDRETYITAHRTPGGGMYRFT
FT                   YNEDHFPVNIELPGGRTVAYEYDIQNRVVKTTDPEGRVTQTQWNGEFDEITRTALDDDA
FT                   VWKTQYNAHGQPVQETDPEGRVTQYAYDEQGQMCSRTDAAGGTVVTAFDSRGQMTRYTD
FT                   CSGRSTGYDHDEDGNLTRVTDAEGKVVRISYNRLGLPETVNSPGKQQDRYTWNALGLMS
FT                   SHRRITGSVESWRYTPRGLLAAHTDEEKRETRWQYTPEGRVAALTNGNGAQYRFSHDAD
FT                   GRLVREVRPDGLSRTFILDDSGYLTAIQTTGTQGGVRRETQQRDALGRLLRTENEHGQR
FT                   TFSYNRLDQITAVTLTPTEAGQQQHRMQADTVRFEYDRSGWLTAEHAGNGSICYQRDAL
FT                   GNPTDITLPDGQHLTHLYYGSGHLLQTALDGLTVSEYERDSLHRQIMRTQGQLATYSGY
FT                   DDDGLLSWQRSLASGSAPVLPGQRPARQGCVTSRDYYWNNHGEVGTIDDGLRGSVVYSY
FT                   DRSGYLTGRSGQMYDHDRYYYDKAGNLLDNEGQGAVMSNRLPGCGRDRYGYNEWGELTT
FT                   RRDQQLEWNAQGQLTRVISGNTETHYGYDALGRRTRKATYGRHTGHTARSRTDFVWEGF
FT                   RLLQENVQQQGWRTYLYDAEQPYTPVASVTGRGESRQVWYYHTDVTGTPQEVTAADGTL
FT                   VWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQD
FT                   PIGLRGGLNLYQYAPNPLKYIDPLGLTATVGRWMGPAEYQQMLDTGTVVQSSTGTTHVA
FT                   YPADIDAFGKQAKNGAMYVEFDVPEKSLVPTNEGWAKIVGPDSIEGRLAKRKGLPVPEM
FT                   PTAENITVRGEKINGEVEAKC"
     MYEAARVDDP IYHTSALAGF LIGAIIGIAI IALAAFAFFS CGFLAGLILG FMADQIASGV        60
     LQLGEAIGRS IHHTAGKILT GSENVSTNSR PAARAVLSTV KCDNHIAEKR IAQGSENIYI       120
     NSQPAARKDD HTECDAVIED GSPNVFLGGG TQTVLEISSE IPDWLRKVVD VLFVVASLLG       180
     GLAGAWRQAA KLGTKFGTKC AAKFIGGELV GMAVGEAISG LFSNPVDVTT GQKILLPETD       240
     FTLPGRLPVT CSRFYASHLE TVGLLGRGWR LNWETSLRDD DEHITLTGVQ GRELRYPKTM       300
     LTPGHQIFDP EEQLYLSRLH DGRYVLHYTD RSYYVFGDFD SDGMAYLLFM ETPHRQRIVF       360
     GHEGGRLVRI ASSSGHHLLL HRTQTPAGER LSRIELVQGG TRGNLVEYRY DDNGQLTGVV       420
     NRAGTQVRQF AYENGLMTAH SNATGFTCRY RWQELDGAPR VTEHDTSDGE HYRFDYDFAA       480
     GTTTVTGRQG ETWQWWYDRE TYITAHRTPG GGMYRFTYNE DHFPVNIELP GGRTVAYEYD       540
     IQNRVVKTTD PEGRVTQTQW NGEFDEITRT ALDDDAVWKT QYNAHGQPVQ ETDPEGRVTQ       600
     YAYDEQGQMC SRTDAAGGTV VTAFDSRGQM TRYTDCSGRS TGYDHDEDGN LTRVTDAEGK       660
     VVRISYNRLG LPETVNSPGK QQDRYTWNAL GLMSSHRRIT GSVESWRYTP RGLLAAHTDE       720
     EKRETRWQYT PEGRVAALTN GNGAQYRFSH DADGRLVREV RPDGLSRTFI LDDSGYLTAI       780
     QTTGTQGGVR RETQQRDALG RLLRTENEHG QRTFSYNRLD QITAVTLTPT EAGQQQHRMQ       840
     ADTVRFEYDR SGWLTAEHAG NGSICYQRDA LGNPTDITLP DGQHLTHLYY GSGHLLQTAL       900
     DGLTVSEYER DSLHRQIMRT QGQLATYSGY DDDGLLSWQR SLASGSAPVL PGQRPARQGC       960
     VTSRDYYWNN HGEVGTIDDG LRGSVVYSYD RSGYLTGRSG QMYDHDRYYY DKAGNLLDNE      1020
     GQGAVMSNRL PGCGRDRYGY NEWGELTTRR DQQLEWNAQG QLTRVISGNT ETHYGYDALG      1080
     RRTRKATYGR HTGHTARSRT DFVWEGFRLL QENVQQQGWR TYLYDAEQPY TPVASVTGRG      1140
     ESRQVWYYHT DVTGTPQEVT AADGTLVWAG YIRGFGENAA DISNSGAYFH QPLRLPGQYF      1200
     DDETGLHYNL FRYYAPECGR FVSQDPIGLR GGLNLYQYAP NPLKYIDPLG LTATVGRWMG      1260
     PAEYQQMLDT GTVVQSSTGT THVAYPADID AFGKQAKNGA MYVEFDVPEK SLVPTNEGWA      1320
     KIVGPDSIEG RLAKRKGLPV PEMPTAENIT VRGEKINGEV EAKC                       1364
//

If you have problems or comments...

PBIL Back to PBIL home page