(data stored in ACNUC7421 zone)

EMBL: AE006468.PE286

AE006468.PE286       Location/Qualifiers
FT   CDS             337830..338276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0293"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19250"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IQ9"
FT                   /protein_id="AAL19250.1"
FT                   /translation="MLNSNMSELRIELENAIKNLGIHDYRVDKPEQIVSEIKEIYVNGN
FT                   PRTWWLSLKHRQYVFSYTDNSGYKNISQIVSKQLNESNVINKHIFLIADEDNEQIYVYN
FT                   VPLNSLPEIIENCRYFEYYVADHELSWLICENDHGDLIVCSTIK"
     MLNSNMSELR IELENAIKNL GIHDYRVDKP EQIVSEIKEI YVNGNPRTWW LSLKHRQYVF        60
     SYTDNSGYKN ISQIVSKQLN ESNVINKHIF LIADEDNEQI YVYNVPLNSL PEIIENCRYF       120
     EYYVADHELS WLICENDHGD LIVCSTIK                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page