(data stored in ACNUC7421 zone)

EMBL: AE006468.PE287

AE006468.PE287       Location/Qualifiers
FT   CDS             338839..339276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0294"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19251"
FT                   /db_xref="InterPro:IPR029278"
FT                   /db_xref="UniProtKB/TrEMBL:Q93IQ8"
FT                   /protein_id="AAL19251.1"
FT                   /translation="MLRFVKPGDIFCFKLDEDRYCFGRIITLMTVGHLSELFDIIKKPP
FT                   GITELEISNARRIIEPIIVDTYSLFDKKLENGSDWRIIGHQVNYNPKNLDGIYFALGIG
FT                   DSCKKKDCYGNDFLISESEWKTLPKLSPKGGFDIKKRLEIA"
     MLRFVKPGDI FCFKLDEDRY CFGRIITLMT VGHLSELFDI IKKPPGITEL EISNARRIIE        60
     PIIVDTYSLF DKKLENGSDW RIIGHQVNYN PKNLDGIYFA LGIGDSCKKK DCYGNDFLIS       120
     ESEWKTLPKL SPKGGFDIKK RLEIA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page