(data stored in ACNUC7421 zone)

EMBL: AE006468.PE288

AE006468.PE288       Location/Qualifiers
FT   CDS             340045..340353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0295"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19252"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK8"
FT                   /protein_id="AAL19252.1"
FT                   /translation="MLTNANKINAVDVFTTGISMVNDKDTAILISDLMLRFGKELDESV
FT                   AVVQSRCDEDEFNVYRETVGFIMGEMLIKIMNPLYEKHPEIKPKGLKQNIWNRMNNV"
     MLTNANKINA VDVFTTGISM VNDKDTAILI SDLMLRFGKE LDESVAVVQS RCDEDEFNVY        60
     RETVGFIMGE MLIKIMNPLY EKHPEIKPKG LKQNIWNRMN NV                          102
//

If you have problems or comments...

PBIL Back to PBIL home page