(data stored in ACNUC7421 zone)

EMBL: AE006468.PE289

AE006468.PE289       Location/Qualifiers
FT   CDS             complement(340455..340703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0296"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19253"
FT                   /db_xref="GOA:Q8ZRK7"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK7"
FT                   /protein_id="AAL19253.1"
FT                   /translation="MARLCGILTYSRVERLSVRLYGEWMPQAGFINGMPVKVRVMRDCI
FT                   VITPQHTHGLFGCIEGMGVTRINKRSAEQWLKTFPGR"
     MARLCGILTY SRVERLSVRL YGEWMPQAGF INGMPVKVRV MRDCIVITPQ HTHGLFGCIE        60
     GMGVTRINKR SAEQWLKTFP GR                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page