(data stored in ACNUC7421 zone)

EMBL: AE006468.PE318

AE006468.PE318       Location/Qualifiers
FT   CDS             371404..372642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0328"
FT                   /product="putative permease"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74668.1); Blastp hit to AAC74668.1 (417 aa), 34%
FT                   identity in aa 33 - 407"
FT                   /db_xref="EnsemblGenomes-Gn:STM0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19282"
FT                   /db_xref="GOA:Q8ZRJ1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ1"
FT                   /protein_id="AAL19282.1"
FT                   /translation="MCMKNNIEETIGKYLPILMILPLAGLAELASLYSIQALLPKLSEV
FT                   YNIPLNQVGMILSAEVGFLALAMLFSGTLSDRFGRKPIIFYSLLAGGILTLLCATASSW
FT                   PMLVVYRALLGIAVSGITAAVTVYISEEVSPALAGIVTGYFIFGNSLGSMSGRVFATLM
FT                   MEHVSIDTIFFIFGGVLIAMALAVKLFLPTSRQFVPTPSLQLGAVLKGGLEHFKNIRVS
FT                   LCFVIGFILFGSFTSIFNFLAFYLHRPPYELSYTWIGLIPVSFSLTFFLAPYAARVALN
FT                   IGSMNALSMLIICMMVGAFLTLIAPSLWVFISGIVLLSVAFFSAHSTVLAWVSSRSPNA
FT                   KGQATSFYLLCYYSGGAVMGYLNGYLFSWQGWNAIAASCLMMLGIGLFICRFIFAKYEK
FT                   QPQIKKQSVQESF"
     MCMKNNIEET IGKYLPILMI LPLAGLAELA SLYSIQALLP KLSEVYNIPL NQVGMILSAE        60
     VGFLALAMLF SGTLSDRFGR KPIIFYSLLA GGILTLLCAT ASSWPMLVVY RALLGIAVSG       120
     ITAAVTVYIS EEVSPALAGI VTGYFIFGNS LGSMSGRVFA TLMMEHVSID TIFFIFGGVL       180
     IAMALAVKLF LPTSRQFVPT PSLQLGAVLK GGLEHFKNIR VSLCFVIGFI LFGSFTSIFN       240
     FLAFYLHRPP YELSYTWIGL IPVSFSLTFF LAPYAARVAL NIGSMNALSM LIICMMVGAF       300
     LTLIAPSLWV FISGIVLLSV AFFSAHSTVL AWVSSRSPNA KGQATSFYLL CYYSGGAVMG       360
     YLNGYLFSWQ GWNAIAASCL MMLGIGLFIC RFIFAKYEKQ PQIKKQSVQE SF               412
//

If you have problems or comments...

PBIL Back to PBIL home page