(data stored in ACNUC7421 zone)

EMBL: AE006468.PE319

AE006468.PE319       Location/Qualifiers
FT   CDS             372774..374195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0329"
FT                   /product="putative 3-isopropylmalate isomerase"
FT                   /note="similar to E. coli 3-isopropylmalate isomerase
FT                   dehydratase subunit (AAC73183.1); Blastp hit to AAC73183.1
FT                   (466 aa), 52% identity in aa 2 - 465; subunit with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:STM0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19283"
FT                   /db_xref="GOA:Q8ZRJ0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRJ0"
FT                   /protein_id="AAL19283.1"
FT                   /translation="MSAKTLYEKLVESHTIRELDNEGHVLLYIDRSILNEYTSPQAFSG
FT                   LRERGRTVRHPDTFLLNIDHVNPTRSQRDDLMTDPGGQLQVDYFRENAADFGITLFDVL
FT                   DPRQGIEHVVAHEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVY
FT                   RKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISALSVEGRMTL
FT                   CNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADAVFDKTVA
FT                   INCHDLEPKVTWGISPDQTGSITGRVPFPEQETNPLKRLALEKALHYMGLTAGMLLKDI
FT                   RISHAFIGSCTNGRIEDLRAVAKVLEGRKIASHVRGIIVPGSTMVRRQAEEEGLAKIFI
FT                   AAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGAGARTHLMSPAMVAAAAV
FT                   AGHLVDVRSLLQAGE"
     MSAKTLYEKL VESHTIRELD NEGHVLLYID RSILNEYTSP QAFSGLRERG RTVRHPDTFL        60
     LNIDHVNPTR SQRDDLMTDP GGQLQVDYFR ENAADFGITL FDVLDPRQGI EHVVAHEQGL       120
     VMPGMVIAAG DSHTTTYGAF GALGFGIGTS EIEHLLATQT LVYRKLKTMR VSVQGELPFA       180
     CSAKDIVLEL LERIGADGAT GYAIEFVGEA ISALSVEGRM TLCNMAVEAG ARGAIIAPDK       240
     KVFDYIYGKP QMPVGELWQQ ALLEWSQLSS DADAVFDKTV AINCHDLEPK VTWGISPDQT       300
     GSITGRVPFP EQETNPLKRL ALEKALHYMG LTAGMLLKDI RISHAFIGSC TNGRIEDLRA       360
     VAKVLEGRKI ASHVRGIIVP GSTMVRRQAE EEGLAKIFIA AGFEWRQSGC SMCLAMNEDV       420
     LSPGDRCASG TNRNFPGRQG AGARTHLMSP AMVAAAAVAG HLVDVRSLLQ AGE              473
//

If you have problems or comments...

PBIL Back to PBIL home page