(data stored in ACNUC7421 zone)

EMBL: AE006468.PE324

AE006468.PE324       Location/Qualifiers
FT   CDS             complement(377574..377846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0334"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI5"
FT                   /protein_id="AAL19288.1"
FT                   /translation="MTLKPGEKSGNNGGIYVEVGPRGGIKDNFATIAETKPRHQRNALK
FT                   ATGCWQKEHLTVNVSQSIWRHDSWRRLITVRPVLYRLASIVQDAP"
     MTLKPGEKSG NNGGIYVEVG PRGGIKDNFA TIAETKPRHQ RNALKATGCW QKEHLTVNVS        60
     QSIWRHDSWR RLITVRPVLY RLASIVQDAP                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page