(data stored in ACNUC7421 zone)

EMBL: AE006468.PE332

AE006468.PE332       Location/Qualifiers
FT   CDS             386311..386610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0342"
FT                   /product="putative periplasmic protein"
FT                   /note="unknown (gi|6707277)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19296"
FT                   /db_xref="GOA:Q8ZRH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH7"
FT                   /protein_id="AAL19296.1"
FT                   /translation="MYYSKRTLLIIFVIFIAIVAIGSIIALEWVNRDSYRTNNLICTTK
FT                   SEAYIAPRKLYMDGGLVLDLKSGRITLHYDVTTDTKEKRLFFVISASANCAERV"
     MYYSKRTLLI IFVIFIAIVA IGSIIALEWV NRDSYRTNNL ICTTKSEAYI APRKLYMDGG        60
     LVLDLKSGRI TLHYDVTTDT KEKRLFFVIS ASANCAERV                               99
//

If you have problems or comments...

PBIL Back to PBIL home page