(data stored in ACNUC7421 zone)

EMBL: AE006468.PE340

AE006468.PE340       Location/Qualifiers
FT   CDS             complement(392420..393931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0350"
FT                   /product="homology to outer membrane efflux protein"
FT                   /note="similar to E. coli putative resistance protein
FT                   (AAC73673.1); Blastp hit to AAC73673.1 (457 aa), 37%
FT                   identity in aa 7 - 457"
FT                   /db_xref="EnsemblGenomes-Gn:STM0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19304"
FT                   /db_xref="GOA:Q8ZRH0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH0"
FT                   /protein_id="AAL19304.1"
FT                   /translation="MRTALIRMISKHNDGNGIMKITFTGYRQTATLATLAFVTTLAGCT
FT                   MAPKHERPASPTAMVYPYATSTVSGAPDAADIGWRDFFHDPLLQELIAIALRNNRDLRK
FT                   AGLNVEAARALYRIQRAEMLPTLGIATAMDASRTPADLSVMDESEINRRYEAAGATTAW
FT                   ELDLWGRVRSLSDQALAAYMALDETYIAARMSLVSEVASAWLTLRADRELLRLTEDTLA
FT                   AQKSSYTLTTQLARTGNATQLDLRMAEIALRSAEINRAAYTRQLARDRNALELLLGQPL
FT                   TPELSRRLNEAVTLTEGAIPTTLPGGLPSDLLVRRPDIRAAEYRLRGANARIGAARAAF
FT                   FPTISLTGSAGTASASLSGLFEPGSGSWRFLPQITLPLFHGGALRADLDRAHVQKQIEI
FT                   ARYENVIQQAFRDVADGLAGQRTLNDQVQSEQRAVEASQIAYELAGLRFQEGVDDYLTL
FT                   LDTHRMLYGAQQRLVRTRLMQQLNIINLYKALGGGWREYSEKKQG"
     MRTALIRMIS KHNDGNGIMK ITFTGYRQTA TLATLAFVTT LAGCTMAPKH ERPASPTAMV        60
     YPYATSTVSG APDAADIGWR DFFHDPLLQE LIAIALRNNR DLRKAGLNVE AARALYRIQR       120
     AEMLPTLGIA TAMDASRTPA DLSVMDESEI NRRYEAAGAT TAWELDLWGR VRSLSDQALA       180
     AYMALDETYI AARMSLVSEV ASAWLTLRAD RELLRLTEDT LAAQKSSYTL TTQLARTGNA       240
     TQLDLRMAEI ALRSAEINRA AYTRQLARDR NALELLLGQP LTPELSRRLN EAVTLTEGAI       300
     PTTLPGGLPS DLLVRRPDIR AAEYRLRGAN ARIGAARAAF FPTISLTGSA GTASASLSGL       360
     FEPGSGSWRF LPQITLPLFH GGALRADLDR AHVQKQIEIA RYENVIQQAF RDVADGLAGQ       420
     RTLNDQVQSE QRAVEASQIA YELAGLRFQE GVDDYLTLLD THRMLYGAQQ RLVRTRLMQQ       480
     LNIINLYKAL GGGWREYSEK KQG                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page