(data stored in ACNUC7421 zone)

EMBL: AE006468.PE341

AE006468.PE341       Location/Qualifiers
FT   CDS             complement(393894..397061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0351"
FT                   /product="putative cation efflux system protein"
FT                   /note="similar to E. coli integral transmembrane protein;
FT                   acridine resistance (AAC76298.1); Blastp hit to AAC76298.1
FT                   (1034 aa), 42% identity in aa 3 - 1030"
FT                   /db_xref="EnsemblGenomes-Gn:STM0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19305"
FT                   /db_xref="GOA:Q8ZRG9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG9"
FT                   /protein_id="AAL19305.1"
FT                   /translation="MKFTHFFIARPIFAIVLSLLMLLAGAIAFLKLPLSEYPAVTPPTV
FT                   QVSASYPGANPQVIADTVAAPLEQVINGVDGMLYMNTQMAIDGRMVISIAFEQGTDPDM
FT                   AQIQVQNRVSRALPRLPEEVQRIGVVTEKTSPDMLMVVHLVSPQKRYDSLYLSNFAIRQ
FT                   VRDELARLPGVGDVLVWGAGEYAMRVWLDPAKIANRGLTASDIVTALREQNVQVAAGSV
FT                   GQQPEASAAFQMTVNTLGRLTSEEQFGEIVVKIGADGEVTRLRDVARVTLGADAYTLRS
FT                   LLNGEAAPALQIIQSPGANAIDVSNAIRGKMDELQQNFPQDIEYRIAYDPTVFVRASLQ
FT                   SVAITLLEALVLVVLVVVMFLQTWRASIIPLVAVPVSLVGTFALMHLFGFSLNTLSLFG
FT                   LVLSIGIVVDDAIVVVENVERHISQGKSPGEAAKKAMDEVTGPILSITSVLTAVFIPSA
FT                   FLAGLQGEFYRQFALTIAISTILSAINSLTLSPALAAILLRPHHDTAKADWLTRLMGTV
FT                   TGGFFHRFNRFFDSASNRYVSAVRRAVRGSVIVMVLYAGFVGLTWLGFHQVPNGFVPAQ
FT                   DKYYLVGIAQLPSGASLDRTEAVVKQMSAIALAEPGVESVVVFPGLSVNGPVNVPNSAL
FT                   MFAMLKPFDEREDPSLSANAIAGKLMHKFSHIPDGFIGIFPPPPVPGLGATGGFKLQIE
FT                   DRAELGFEAMTKVQSEIMSKAMQTPELANMLASFQTNAPQLQVDIDRVKAKSMGVSLTD
FT                   IFETLQINLGSLYVNDFNRFGRAWRVMAQADAPFRMQQEDIGLLKVRNAKGEMIPLSAF
FT                   VTIMRQSGPDRIIHYNGFPSVDISGGPAPGFSSGQATDAIEKIVRETLPEGMVFEWTDL
FT                   VYQEKQAGNSALAIFALAVLLAFLILAAQYNSWSLPFAVLLIAPMSLLSAIVGVWVSGG
FT                   DNNIFTQIGFVVLVGLAAKNAILIVEFARAKEHDGADPLTAVLEASRLRLRPILMTSFA
FT                   FIAGVVPLVLATGAGAEMRHAMGIAVFAGMLGVTLFGLLLTPVFYVVVRRMALKRENRV
FT                   DSHDQQA"
     MKFTHFFIAR PIFAIVLSLL MLLAGAIAFL KLPLSEYPAV TPPTVQVSAS YPGANPQVIA        60
     DTVAAPLEQV INGVDGMLYM NTQMAIDGRM VISIAFEQGT DPDMAQIQVQ NRVSRALPRL       120
     PEEVQRIGVV TEKTSPDMLM VVHLVSPQKR YDSLYLSNFA IRQVRDELAR LPGVGDVLVW       180
     GAGEYAMRVW LDPAKIANRG LTASDIVTAL REQNVQVAAG SVGQQPEASA AFQMTVNTLG       240
     RLTSEEQFGE IVVKIGADGE VTRLRDVARV TLGADAYTLR SLLNGEAAPA LQIIQSPGAN       300
     AIDVSNAIRG KMDELQQNFP QDIEYRIAYD PTVFVRASLQ SVAITLLEAL VLVVLVVVMF       360
     LQTWRASIIP LVAVPVSLVG TFALMHLFGF SLNTLSLFGL VLSIGIVVDD AIVVVENVER       420
     HISQGKSPGE AAKKAMDEVT GPILSITSVL TAVFIPSAFL AGLQGEFYRQ FALTIAISTI       480
     LSAINSLTLS PALAAILLRP HHDTAKADWL TRLMGTVTGG FFHRFNRFFD SASNRYVSAV       540
     RRAVRGSVIV MVLYAGFVGL TWLGFHQVPN GFVPAQDKYY LVGIAQLPSG ASLDRTEAVV       600
     KQMSAIALAE PGVESVVVFP GLSVNGPVNV PNSALMFAML KPFDEREDPS LSANAIAGKL       660
     MHKFSHIPDG FIGIFPPPPV PGLGATGGFK LQIEDRAELG FEAMTKVQSE IMSKAMQTPE       720
     LANMLASFQT NAPQLQVDID RVKAKSMGVS LTDIFETLQI NLGSLYVNDF NRFGRAWRVM       780
     AQADAPFRMQ QEDIGLLKVR NAKGEMIPLS AFVTIMRQSG PDRIIHYNGF PSVDISGGPA       840
     PGFSSGQATD AIEKIVRETL PEGMVFEWTD LVYQEKQAGN SALAIFALAV LLAFLILAAQ       900
     YNSWSLPFAV LLIAPMSLLS AIVGVWVSGG DNNIFTQIGF VVLVGLAAKN AILIVEFARA       960
     KEHDGADPLT AVLEASRLRL RPILMTSFAF IAGVVPLVLA TGAGAEMRHA MGIAVFAGML      1020
     GVTLFGLLLT PVFYVVVRRM ALKRENRVDS HDQQA                                 1055
//

If you have problems or comments...

PBIL Back to PBIL home page