(data stored in ACNUC7421 zone)

EMBL: AE006468.PE36

AE006468.PE36        Location/Qualifiers
FT   CDS             41723..42913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0036"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /note="similar to E. coli putative arylsulfatase regulator
FT                   (AAC76803.1); Blastp hit to AAC76803.1 (411 aa), 46%
FT                   identity in aa 8 - 401"
FT                   /db_xref="EnsemblGenomes-Gn:STM0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19000"
FT                   /db_xref="GOA:Q8ZRZ6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034491"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ6"
FT                   /protein_id="AAL19000.1"
FT                   /translation="MMFGKSCQVMVKPTGSVCNLDCKYCFYLEKEKLYPDRKNHYKMSE
FT                   ETLELFIRQQIAAQDIDEVIFAWQGGEPTLMGIPFYRKAVEFQQRYCGGKTIVNTFQTN
FT                   GILINDDWATFFREHDFLVGVSIDGDAALHDEWRVTRSGKPTHEKVENAVRCLAQHDVE
FT                   FNTLTVVNRTNMHHPVQVYRYLKSIGSRYMQFIPLVERCGENGLAQPQDKHIAMTPWSV
FT                   DSLQFGQFLNAVFDIWIREDIGDIGIQLFEQTLAAWCGLPPQVCVFAPTCGSAFAMEMN
FT                   GDVYNCDHFVYPQFKLGNIHQKTLRQMNQGEQNRQFGSDKQRSMAQECHRCQWKFACYG
FT                   GCPKHRFLPSASGATNHNYLCAGYQAFFSHTATAMSAMRTLYEKGISPAEIKSIFV"
     MMFGKSCQVM VKPTGSVCNL DCKYCFYLEK EKLYPDRKNH YKMSEETLEL FIRQQIAAQD        60
     IDEVIFAWQG GEPTLMGIPF YRKAVEFQQR YCGGKTIVNT FQTNGILIND DWATFFREHD       120
     FLVGVSIDGD AALHDEWRVT RSGKPTHEKV ENAVRCLAQH DVEFNTLTVV NRTNMHHPVQ       180
     VYRYLKSIGS RYMQFIPLVE RCGENGLAQP QDKHIAMTPW SVDSLQFGQF LNAVFDIWIR       240
     EDIGDIGIQL FEQTLAAWCG LPPQVCVFAP TCGSAFAMEM NGDVYNCDHF VYPQFKLGNI       300
     HQKTLRQMNQ GEQNRQFGSD KQRSMAQECH RCQWKFACYG GCPKHRFLPS ASGATNHNYL       360
     CAGYQAFFSH TATAMSAMRT LYEKGISPAE IKSIFV                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page