(data stored in ACNUC7421 zone)

EMBL: AE006468.PE372

AE006468.PE372       Location/Qualifiers
FT   CDS             435598..436809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0382"
FT                   /product="putative permease"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74137.1); Blastp hit to AAC74137.1 (408 aa), 60%
FT                   identity in aa 11 - 405"
FT                   /db_xref="EnsemblGenomes-Gn:STM0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19336"
FT                   /db_xref="GOA:Q8ZRF1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF1"
FT                   /protein_id="AAL19336.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
     MESWKVNLIS VWFGCFFTGL AISQILPFLP LYISQLGVSS HEALSMWSGL TFSITFLISA        60
     IVSPMWGSLA DRKGRKLMLL RASLGMAIAI LLQAFATHVW QLFLLRGIMG LTSGYIPNAM       120
     ALVASQVPRE RSGWALSTLS TAQISGVIGG PLMGGFVADH IGLRAVFLIT AMLLVVSFLV       180
     TLFLIKEGVR PVIKKSERLS GKAVFASLPY PALVISLFFT TMVIQLCNGS ISPILALFIK       240
     SMMPDSNNIA FLSGLIASVP GISALISAPR LGKLGDRIGT ERILMATLIC AVLLFFAMSW       300
     VTTPFQLGLL RFLLGFADGA MLPAVQTLLV KYSSDQITGR IFGYNQSFMY LGNVVGPLMG       360
     ATVSAMAGFR WVFIATAAIV LINIGQLTLA LRRRRNAQKA KGQ                         403
//

If you have problems or comments...

PBIL Back to PBIL home page